KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_2456Help
Entry
CYB_2456          CDS       T00319                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cyb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CYB_2456 (hemB)
Enzymes [BR:cyb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     CYB_2456 (hemB)
Exosome [BR:cyb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CYB_2456 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(2555326..2556312)
Genome map
AA seq 328 aa AA seqDB search
MSQDLIYRPRRLRRTEAFRQMVQETHLRVQDLIYPLFVMEGENQRQEVESMPGCYRYTLD
LLLKEVEEAAQLGIPAVALFPVVPEEKKDPTGQECFNPEGLIQRAVRRIKQEIPEILVVT
DVALDPYNSDGHDGIVRDGVILNDETVEVLVKQALSQAEAGTDIVAPSDMMDGRVGAIRE
ALDDQGYTDVAILAYSAKYASAFYGPFRDALGSAPKSGDKKSYQMDPANAREAIKEVELD
EAEGADMVMVKPALAYLDIIYRVKESTDLPVAAYNVSGEYAMIKAAEQKGWIDGKKVMLE
SLLAMKRAGADIILTYFAKEVALLLKQA
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgagccaagacctgatctaccgtccccgtcggctgcggcgcacagaggccttccgccag
atggtgcaggaaacccacctgcgggtgcaggatctgatctatcccctgtttgtcatggag
ggggagaaccagcggcaggaagtggagtcgatgcccggctgctaccgctacaccctagac
ctgctgctaaaggaggtggaagaagccgctcaactggggatcccggcggtggccctgttc
ccggtggtgccggaagagaaaaaggatcccaccgggcaggagtgcttcaacccggaaggc
ttgatccagcgggcggtgcggcggattaaacaggaaattcccgagatcttggtggtaacc
gatgtggccttggatccttacaacagcgacggccacgacggcattgtgcgggatggggtg
atcctcaacgacgagacggtggaagttttggtcaagcaagccctctcccaagcagaggcg
ggaaccgacattgtggccccctcggacatgatggacggtcgtgtcggcgccattcgggag
gccctggacgaccaaggctataccgatgtggcgatcctggcctactctgccaaatatgcc
tctgccttctacggtcccttccgcgatgccctgggatccgcgcccaaatcgggagacaag
aaaagctatcaaatggatcccgccaatgctcgggaagccatcaaagaggtggagctggac
gaggccgagggggcggacatggtgatggtgaagccggccctggcctacctggacatcatc
taccgagttaaggaatcgacggatctgcccgtggctgcctacaacgtcagcggcgagtac
gccatgatcaaagccgccgaacaaaaaggctggatcgacggcaaaaaagtgatgttggaa
tccctgctggccatgaagcgggctggcgccgatatcatcctcacctactttgccaaagag
gtggccttgcttctcaaacaagcctag

DBGET integrated database retrieval system