KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_2895Help
Entry
CYB_2895          CDS       T00319                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cyb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CYB_2895 (recR)
DNA repair and recombination proteins [BR:cyb03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      CYB_2895 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2993670..2994269
Genome map
AA seq 199 aa AA seqDB search
MYTRPLARLIEELQRLPGIGSKTAQRLALHLINRPAGEIEALAKALLEAKQTVRHCSICF
NWSAEDPCEICRSPQRDPSLWCVVADVKDLIAMERTREFKGLYHVLGGLISPMNGIGVDQ
LHIRELVARVAREKPQELIFAISPSVEGEVTMHVVKDYLKPVAPTLRMTRLAFGLPMGSE
LEYADEVTLARALEARQEL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgtacactcgccccttggctcgcctcatcgaagagctgcaacggctgcccggcattggc
tccaaaaccgctcagcgcctagctctccacttgatcaaccggcctgccggcgagatcgag
gccctggccaaagccctgctggaagccaagcaaaccgttcggcactgttccatctgcttc
aactggtcggcggaggatccctgtgagatttgccgttcgccgcagcgggatccctcgctg
tggtgcgtggtggccgatgtcaaagatttgattgcgatggaacgcacccgcgagttcaag
gggctttaccacgttttgggtggcctcatctcccccatgaacgggatcggggtcgatcaa
ctgcacatccgcgagctggtggctcgggtggcacgggaaaaaccgcaggagctgatcttt
gccatcagccccagcgtagagggggaagtaaccatgcacgtggtcaaggattacctgaag
ccggttgcccccaccttgcgcatgacccgcctggccttcggcctgcccatgggatccgag
ctggaatatgccgacgaggttaccctggcccgtgccttggaagcgcggcaggagttgtga

DBGET integrated database retrieval system