KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_2922Help
Entry
CYB_2922          CDS       T00319                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cyb00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(3020433..3021335)
Genome map
AA seq 300 aa AA seqDB search
MLFAQDHLLKVRSVTSLTSRRPLPRAEKAAEGYRLSWRGVAVMGVLNVTPDSFSDGGLWG
SPEAAVQAAKAMAAAGALIVDIGGESTRPGAEPVSVEVECDRVLPVIRALEGSGIPISVD
TRRTEVAAAALAAGAHIINDVSGLRDPQMIQVCAEKGVPAVIMHMRGEPRTMQQQTDYAD
LEGEVFGFLREQAERALAAGVPSVVLDPGLGFAKTAEQNVTLLKALPRLVAYGYPVLVGA
SRKSFVGKLSGIAVPSERDSASVAVHLFAASRGAALVRVHNVPAHVSALATWEALHHDAG
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgctctttgcgcaggatcatcttctgaaggttagaagtgttaccagcttgacctctcgg
cgtcccctgcccagggccgaaaaggcggcggaaggctatcgcctctcgtggcgcggggtt
gcggtgatgggggtgctcaacgtaacacccgacagctttagcgatggcggcctgtgggga
tccccagaagcagccgtgcaggcagccaaagccatggcagcggcaggggccttgatcgtg
gatattggcggcgagtccacccgtccgggagcggagccggtatcggtggaggtggaatgc
gaccgagtcttgcccgtgatccgggccctggaaggatccgggatccccatcagcgtcgat
acgcgcagaacggaggtggcggctgcggctttggctgccggggcgcacatcatcaacgat
gtcagcgggctgcgggatccccaaatgatacaggtctgtgccgaaaagggggtgccggcg
gtgatcatgcacatgcggggagaaccgcgcaccatgcagcagcagaccgactatgctgac
ctggagggggaggttttcggttttctcagggaacaggcggagcgggccctggcagcgggc
gtgcccagcgttgttttggatccgggcttgggctttgccaaaactgctgagcagaatgta
accctgctcaaagccctaccgcggctggtggcctacggctacccagttttggtgggggca
tcccgcaaaagttttgtgggcaagctttccggcattgccgtgcccagcgagcgagacagc
gccagcgtggccgtgcacctgtttgcagccagccggggggctgccctggtacgggttcac
aacgtgccggctcatgtttccgcccttgccacttgggaagctctgcaccatgacgcaggg
tag

DBGET integrated database retrieval system