KEGG   Cyanothece sp. PCC 7424: PCC7424_0289Help
Entry
PCC7424_0289      CDS       T00808                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
cyc00900  Terpenoid backbone biosynthesis
cyc01100  Metabolic pathways
cyc01110  Biosynthesis of secondary metabolites
cyc01130  Biosynthesis of antibiotics
Module
cyc_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:cyc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PCC7424_0289
Enzymes [BR:cyc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     PCC7424_0289
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C
Motif
Other DBs
NCBI-ProteinID: ACK68757
JGI: PCC74240289
UniProt: B7KAT5
Position
315400..316596
Genome map
AA seq 398 aa AA seqDB search
MKKISVLGSTGSIGTQTLDIVAQYPDQFQVVGLAAGNNVELLSAQVHQFRPEIVAICNLD
HLEVLKESLSSLDYSPIILGGEQGIVEVAGYGDAQSVVTGIVGCAGLLPTIAAIKAGKDI
ALANKETLIAGGPVVLPLIEKHGVKLLPADSEHSAIFQCLQGVPEKGLRKILLTASGGSF
RDLPVEKLSTVTVQDALKHPNWSMGRKITIDSATLMNKGLEVIEAHYLFGLDYDRIEIVI
HPQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPERIYTDWETLDLVKVGSLTFREP
DHHKYPCMKLAYAAGRAGGAMPAVLNAANEQAVALFLEERIGFLDIPRLIETVCDRFTTH
NQAHPTLDDIISADQWARGEVIRANEVIEKSDRIVSVR
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaaatttctgttcttggttcaacaggttctataggaactcaaaccctcgatatt
gtcgctcaatatccggatcaatttcaagtggttgggttagcagccggtaacaatgtagaa
ttactctcggcacaagtgcatcaattccgcccggaaattgtcgctatttgtaatcttgac
catctcgaagtccttaaagagtctctctcctccctcgattattctccgattattttaggg
ggagaacagggtatagttgaagtggccggttatggggatgctcaaagtgtagttacgggt
atcgtcggatgtgccgggttattaccgactattgctgctattaaagcgggtaaagatatt
gctttagcgaataaagaaaccttaatcgctggggggccggtggtgttacccttaatcgaa
aaacatggggtaaaattattaccggcggactcagaacattcggctatttttcaatgtttg
caaggagtccccgaaaaaggtctcagaaaaattcttttaaccgcttctggggggtctttt
cgagatttacccgtcgaaaaattaagcaccgttacggtacaggatgccctaaaacatccc
aattggtcaatgggacgcaaaattaccattgattctgctaccctaatgaataagggatta
gaggtcatagaagctcattacttatttggcttagattacgatcgcatcgaaattgtgatt
catccccagagtattattcattctcttattgagttacaagatacctcagttttggctcaa
ttggggtggccggatatgcgtttacctttgctttatgcgttatcttggccagaacgaatt
tataccgattgggaaactttagacttagttaaagtgggaagtttgactttccgagaaccg
gatcatcataagtatccttgcatgaaattagcttatgcggcgggacgggcagggggtgct
atgccggcggttttaaatgcggctaatgaacaagcagttgctctctttttagaggaaaga
attggctttttagatattcctcgcttaattgaaacggtttgcgatcgctttaccactcac
aatcaggctcatcctacattagatgatatcatatctgccgatcaatgggcgagaggggaa
gtgattcgggctaatgaagttatagaaaaaagcgatcggattgtgtctgttcggtaa

DBGET integrated database retrieval system