KEGG   Cyanothece sp. PCC 7424: PCC7424_0300Help
Entry
PCC7424_0300      CDS       T00808                                 

Definition
(GenBank) ATP-grasp domain protein
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
cyc00020  Citrate cycle (TCA cycle)
cyc00640  Propanoate metabolism
cyc00660  C5-Branched dibasic acid metabolism
cyc01100  Metabolic pathways
cyc01110  Biosynthesis of secondary metabolites
cyc01120  Microbial metabolism in diverse environments
cyc01130  Biosynthesis of antibiotics
cyc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cyc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PCC7424_0300
   00640 Propanoate metabolism
    PCC7424_0300
   00660 C5-Branched dibasic acid metabolism
    PCC7424_0300
Enzymes [BR:cyc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PCC7424_0300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ACK68768
JGI: PCC74240300
UniProt: B7KAU6
Position
complement(325889..327139)
Genome map
AA seq 416 aa AA seqDB search
MDLLEYHAKELFHQVGIPILPSQPIHDPGELKRLHIPYPVVLKSQVRAGGRGKSGGIRFV
ENTIDAIAAARAIFTLPIFGEYPEVLLAEARYNAQEEFFLAIVLDYQLQRPVLLGSPKGG
MNIEALLEYMQRVVIEDEFSPFYARRLAKKMGIAENLIQSVSAIIEKMYYLFIEKDLDLI
EINPLGVSQQGEVMALDGKISVNDYALSRHPELVGLTSAKKEVSSENGNGESEPIINLHW
LEDSDELGNVAIICNSLDLALMNWQLITQEKGKPSYCLILQENSYSPSIPQQLEMGLEKI
TELSALKVILVNIVGSPEVSETVAKAIANYLQPQLKQQLSPKGEERLIRATGAASTRKRS
TKTRSQQSQPHQIQWVIRLINGEIEALQETLSVLPVYWTKTLDDAVSKTLSILKTK
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggatttattagaatatcatgccaaagaactgtttcatcaagtcgggattcctattttg
ccatcccaacccattcatgatccaggagaattaaaaagattacacataccttatccagtc
gtcttaaaatcccaagttcgcgccggcgggaggggaaaatccggcggcattcgctttgta
gaaaataccattgatgcgatcgctgccgctagagcaatttttaccttacccattttcgga
gaatatccggaagttcttctagcagaagctcgttataatgctcaagaagaattttttctc
gctattgtacttgattatcaactccaacgccctgtattgcttggttctcctaaaggagga
atgaacatagaagcccttttagagtatatgcaaagggttgtgatagaagatgaattttct
cctttttatgctcgtcgtttagcgaaaaaaatgggcattgctgaaaacctaattcagtca
gtcagtgccatcattgaaaaaatgtattatttatttatcgaaaaagacttagatttaata
gaaattaatcctttaggagtcagtcaacaaggagaagtcatggctcttgatggcaaaatt
tccgtgaatgattatgctctttctcgtcatcctgaattagtggggttaacgtcggcaaaa
aaagaggtttcctcagaaaatggaaatggagaatcagaacccataatcaatctccattgg
cttgaagattcagatgaattaggaaatgtggcgattatttgtaatagtttagatctcgcc
ttaatgaattggcagttaatcactcaagaaaaaggaaaaccttcttattgtttaatttta
caagaaaattcctatagtccttctatccctcaacaattagaaatgggactcgaaaaaatt
accgaattatcagccttaaaagtcatcctggttaatattgttgggagtcctgaagtgagt
gaaacagtcgccaaagcgatcgctaattatcttcaacctcaactgaaacagcaattatct
ccaaaaggagaagaaagactcattagagcaaccggtgcggcttcaactcgaaaacgctcc
actaaaactcgttctcaacagagccaacctcatcaaatacaatgggttattcgtctcatt
aatggggaaattgaagccttacaagaaactttatcagtgttgcccgtctactggacaaaa
accttagatgatgctgttagtaaaactctctcaattttaaaaaccaaataa

DBGET integrated database retrieval system