KEGG   Cyanothece sp. PCC 7424: PCC7424_0379Help
Entry
PCC7424_0379      CDS       T00808                                 

Definition
precorrin-3B C(17)-methyltransferase
Orthology
K13541  
cobalt-precorrin 5A hydrolase / precorrin-3B C17-methyltransferase [EC:3.7.1.12 2.1.1.131]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PCC7424_0379
Enzymes [BR:cyc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.131  precorrin-3B C17-methyltransferase
     PCC7424_0379
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.12  cobalt-precorrin 5A hydrolase
     PCC7424_0379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(411372..413267)
Genome map
AA seq 631 aa AA seqDB search
MLLFLKNPLSLSPFTPFQPIAAIATTQTAAETLSPLCQTLGATLHLPDSLTPLHQAQIYT
GSLKEYLPILWNTHKTLIFCLATGAVVRLIAPLLENKAEDPAILVIDQKGKFVISLCSGH
QGGADRLTQLIATGLDAIPIITGASASLGLLALDILGFPFGWRKGEGDWTGVSAAIANGK
TVQVIQEAGSTLWQNHLPEDHSFYFGFPEHNQPIAFSGRIWISATKRKFASSSDFPKVQW
HPRVLWVGIGCIRGTSRQLIETAIEEVFQRYHLATEAIAGLGTIEIKGDEIGLLEYIEQK
QYPFKTFSAEVLKSINVPNPSTVVDQEVGTPSVAEASALCAAKTHFSSTENPVLIVPKQI
IKSDSESGAVTVAIAQSEIEYTARKGQLWLVGIGPGKLEQITPAAATAIKQADVIIGYSL
YLDLIKPLNRTGQIIESFPITQEQKRAQRAIELAQWGLTVAVISSGDCGIYGMGGLVLEE
LQKTGWDGYHPQVEIFAGITAIQAAAARVGAPLMHDFCTISLSDLLTPWEVIEKRLEAAA
QADFVTGIYNPRSQTRTGQIVKAQEIYLKYRSPHTPIAIVRSAYRQDEHITLTTLEKMLD
FPIDMLTTVIIGNSSTRDYKNWLITPRGYRS
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
ttgttattgtttttaaaaaatcccttgagtttatccccttttactccctttcaacccatc
gcagcgatcgcaaccacccaaaccgccgccgaaaccttatctcccctctgtcaaaccctc
ggcgcaactcttcacctacccgactccctaactcccctccatcaggctcaaatttacacc
ggttcattaaaagaatatctccctattctctggaatacccataaaaccctgattttttgt
ctggcaacgggggcagtagtccgtttaatcgcccctttactcgaaaataaagcagaagat
cccgccattttagtgatcgatcaaaagggaaaatttgtcattagtctctgtagtggtcat
caaggaggggccgatcgtttaacccaattaattgccactgggttagacgcaattccgatt
ataacaggggcatccgcgagtttaggactgctggcgctcgatattttagggtttcctttt
gggtggcgcaaaggtgagggagattggacaggagttagtgcggcgatcgccaacgggaaa
acagtacaagtgattcaagaagccggctcaaccctatggcaaaatcatttaccagaagat
cattccttttattttgggtttcctgaacataatcaaccgatagcattttctgggagaatt
tggatcagcgccactaaacggaaatttgcctcctcctcagattttcccaaagtccaatgg
catcctagagtgttatgggtgggaataggatgtattcggggaacttcccgacaattgatc
gaaaccgctatagaagaagtttttcaacgctatcatttagctacagaagcgatcgctggt
ttagggacgatagagataaaaggggatgaaatcggactattagagtatattgagcaaaaa
caatacccttttaaaaccttttctgctgaagttttaaaatctataaatgttcccaacccc
tcaacagttgtagaccaagaagtaggaactcctagcgttgctgaagcttccgctttatgt
gccgccaaaacccatttttcctctacagaaaaccccgttttaattgttcctaaacaaatt
atcaaatcggacagtgaatccggagcagtaacagtcgccattgctcaatctgagatagaa
tatacagcacgaaagggacaattatggttagttggaatcggccccggaaagttagagcaa
attaccccggctgctgccactgcgattaaacaagcggatgttattattggttattctctc
tatcttgatttaattaaacccttaaaccgtaccggacaaattatcgaatcttttcccatt
actcaagaacaaaaacgggcacaaagagctatagaattagctcaatggggattaacagta
gcggttatttcttcgggagattgtgggatttatggaatggggggattagtgttagaagaa
ctccaaaaaaccggctgggatggttatcatccacaagttgaaatttttgctgggattact
gcgatacaagcagcagcagcaagggttggcgcacctctaatgcacgatttttgtaccatt
agtttaagtgatttattaaccccttgggaagtgatagaaaaacgcttagaagccgccgca
caagccgattttgtcacgggtatttataatcctcgctcccaaactcgtaccggacaaatt
gttaaagcacaagagatatatttaaagtatcgctctcctcatacgcctattgctatcgtt
cgttcagcttatcgtcaagatgaacatattaccttaacaacccttgagaaaatgttagat
ttccctatcgatatgttaacgacagttattattggcaatagtagcactcgtgactataaa
aattggctaattacgccacgaggttatagaagttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system