KEGG   Cyanothece sp. PCC 7424: PCC7424_0451Help
Entry
PCC7424_0451      CDS       T00808                                 

Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyc00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PCC7424_0451
   00330 Arginine and proline metabolism
    PCC7424_0451
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    PCC7424_0451
Enzymes [BR:cyc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     PCC7424_0451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
498726..499637
Genome map
AA seq 303 aa AA seqDB search
MNKLETLQPQHLLEWVKLAQQKASFGKTPDYIPLLHQTDPQLFSASILTLNHQTYSLGNS
ELTFPLMSVIKPFLLFYVLSHLGTETVFKRVGNQPSDYPFNALEQLIADGGFPRNPMINS
GAITLASLLPGKDGIECGESLRLWLNQWGNCQLFLDRLMLESVQSLPNPRNQALLQELSA
KGSLKNPQLALNTYNYICCLAGNTIDLARLGLLLINPPSPLQKDHCQIVQNLMITCGLYE
SSREFAQRVGLPTKSGVSGAVLSIVPEQGAIACYSPPLDQRGNSLAGLFLVEEIAKAIFC
SLG
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaattagaaactttacaaccacaacaccttttagaatgggtaaaattagcccaa
caaaaagcctcattcgggaaaactcctgattatatccctttactccatcaaaccgatcct
cagttattttcagcctctattttaaccctaaatcatcagacttattctctgggtaattcc
gagttaacttttcccttaatgagtgtaattaaaccctttcttttattctatgtattatct
catttagggacagaaaccgtatttaaacgggtaggaaatcaaccgtctgattatcctttt
aatgctttagaacaattgattgccgatggggggtttcctcgtaatccgatgattaatagt
ggggcgattactttagcgtctttgttacccggaaaagatgggattgagtgcggtgaaagt
ttacggctttggctcaatcaatggggcaattgtcagttatttttagaccggttaatgtta
gaatctgtccaatctctgcctaatcctcgcaatcaagcgcttttacaagaattgtccgct
aaaggttcgcttaaaaatcctcaattagccctcaatacttataattatatctgttgttta
gccggtaatacgattgacttggctcgtctgggattattattaattaatcctccttcccct
ctgcaaaaagaccattgtcaaattgtacaaaacttaatgataacttgtgggctttatgaa
agttcgagggaatttgctcaacgggtaggtttacccactaaatctggtgttagtggggca
gtgttatctattgtacccgaacaaggggcgatcgcttgttacagtcctcctttagatcaa
cggggaaactcattagccggattatttttagttgaagaaattgctaaagcgatattttgt
agcttgggttga

DBGET integrated database retrieval system