KEGG   Cyanothece sp. PCC 7424: PCC7424_1189Help
Entry
PCC7424_1189      CDS       T00808                                 

Definition
CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:cyc02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:cyc02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1301961..1302977)
Genome map
AA seq 338 aa AA seqDB search
MLGRIIVIGASAGGVEALRELVAGFPSDLPATIFIVLHISPNSGSVLPSILTRAGVLEAV
YPENEEVFQPGRIYVAPPDHHLLVKLGKVELTRGPKENRNRPAIDVLFRSAARAYDSLVI
GVVLSGLLDDGTAGLLAIKQRGGIAIVQDPEEALYSSMPRNAIENVEVDQVLSVKEIAKE
LTRLVYEPIELKEVPPVSKNFAMESDMATLEPEAMQSDERPGIPSGFACPDCGGVLWELN
QGNLLRFRCRTGHAFSVESLLAQQSEELEEALWVALRTLEETANLRDRMAQRATQAGHTA
RARIYDEDAQTARQRALLIRKAILNGLNGKNKDQLDEA
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgttaggaaggattattgttattggggcttcggcgggtggtgtagaggcacttagagag
ttggtagcgggtttcccttcagatttaccagcgactatttttatcgtgcttcacatttct
cctaacagtggtagcgttttaccgagcattctgactcgtgcaggtgttttagaagcagtt
tatccagaaaatgaggaagtatttcagcccggacgcatttatgtcgccccgccggatcat
catttattggtcaaattaggtaaagttgaattaacccgtggccctaaagaaaatagaaat
cgtcctgctattgatgtgctatttcggagcgcggccagggcttatgattctttagttatc
ggggtggtattatcggggcttctcgatgatggaacggcggggttattagcgattaaacaa
cgaggagggatcgctattgttcaagatcccgaggaagcactttattctagtatgcctcgc
aatgcgatcgagaatgtagaagtcgatcaagtcttatcggtaaaggaaattgccaaggaa
ctcacgcgcctagtttatgaacctatagaactaaaagaagtccctcccgtgtctaaaaat
tttgcaatggagtcggatatggcgactttagaaccagaggctatgcaaagcgacgaacgc
cccggaattccttcaggttttgcctgtcctgattgtggtggggttttatgggaattaaat
caaggcaatttgctccgttttcgctgtcgtaccggtcatgcgttttctgtggagagttta
ttggcgcaacagtcggaagaactcgaagaggctttatgggtggcgctgagaaccttggag
gaaaccgccaatctcagggataggatggctcaacgggcgactcaagccggtcataccgca
agagcgcgtatttatgatgaggatgcccaaaccgctagacaacgggctttattgatccga
aaagcaattttaaatgggcttaatgggaaaaataaagatcagttggatgaagcttaa

DBGET integrated database retrieval system