KEGG   Cyanothece sp. PCC 7424: PCC7424_1263Help
Entry
PCC7424_1263      CDS       T00808                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
cyc00010  Glycolysis / Gluconeogenesis
cyc00030  Pentose phosphate pathway
cyc00051  Fructose and mannose metabolism
cyc00052  Galactose metabolism
cyc00680  Methane metabolism
cyc01100  Metabolic pathways
cyc01110  Biosynthesis of secondary metabolites
cyc01120  Microbial metabolism in diverse environments
cyc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cyc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PCC7424_1263
   00030 Pentose phosphate pathway
    PCC7424_1263
   00051 Fructose and mannose metabolism
    PCC7424_1263
   00052 Galactose metabolism
    PCC7424_1263
  Energy metabolism
   00680 Methane metabolism
    PCC7424_1263
Enzymes [BR:cyc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PCC7424_1263
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     PCC7424_1263
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ACK69710
JGI: PCC74241263
UniProt: B7K7E2
Position
1399457..1400668
Genome map
AA seq 403 aa AA seqDB search
MSKKKRIGILTSGGDCPGLNAIIRAVVKAANRKNWEVYGLPYGTDGFIHLAKGLCTPDEL
RLTTHGYDLPGHLQGIDILQFLSGSILGSLSKGDPQDPEIAQSILDGYERLGLDALIAIG
GDGSLDIIYDLAQKGHWNFVAIPKTIDNDVPFTERSVGFDTAVDTVTHALYDLTFTAASH
ERVMIVQVMGRDAGHLALHAGIAGGADVILIPELVPHLSDQVVEGCCRQMADIRSTGRQF
ALIVLSEGVKNDNNGKEKYIGDYLANRINEQSHKLCENGLEEFCSLKNIDVRVTVLGHLQ
RSGTPSSSDRLIGTAFGIKAIELIEQEAYSRLVVWQHGGVYSQPLDQVIAVIRQCHRDNR
CAYPVDPDGFMVQTARSLNIYLGDQHLPLSDLDPKPTSFQLAV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaaaaaaacggattggaattttaaccagtgggggcgattgtcctggattaaat
gccattattcgggcagttgttaaagccgctaaccgaaaaaattgggaagtttatggatta
ccttatggaacagatggatttattcatctagcaaaaggtctttgtactcccgacgaactc
agattaaccactcatggttatgatctgcccggacatttgcaagggatagatattctgcaa
tttctgagtgggagtatcttaggttctctgagcaaaggagatcctcaagatccagaaata
gctcagtcaattttagacggatatgaacgcttagggctagatgctcttattgctattggt
ggggatggaagtttagatattatttatgacttagctcaaaaaggtcattggaattttgtc
gctattcccaaaaccattgataatgatgtccccttcaccgaacgctcagtcgggtttgat
acggcggtggatacggttactcatgctctttatgatctaacctttaccgccgcctctcac
gaacgggtaatgatcgttcaagtgatgggaagagatgccggacatttagcactccatgcc
ggtattgcagggggagcagatgtgattttaattcctgaattagtccctcatctctcggat
caggtggttgagggttgttgtcgccaaatggctgatattcgctcaactggtcgccaattt
gccttaattgttctctctgaaggggtgaaaaatgataataatggaaaagagaaatatatt
ggggattatttagccaatcgcattaacgaacaaagtcacaaattatgtgaaaacggacta
gaagaattttgttccctgaaaaatattgatgtacgagtgacggttttaggacacctacaa
cgtagcggaacgccttctagtagcgatcgcttaattgggacagctttcgggataaaagcc
atagaattaattgaacaggaagcctattctcgtcttgtggtttggcaacatggaggagtt
tatagtcaacccctcgatcaagtcattgctgtgattcgacaatgtcatcgagataatcgt
tgtgcttatccggttgatcccgatggatttatggtacaaaccgcccgatcgctcaatatc
tatctaggggatcaacatcttcctctaagtgatcttgaccctaaacccaccagttttcag
ttagcggtgtaa

DBGET integrated database retrieval system