KEGG   Cyanothece sp. PCC 7424: PCC7424_1263Help
Entry
PCC7424_1263      CDS       T00808                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cyc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PCC7424_1263
   01230 Biosynthesis of amino acids
    PCC7424_1263
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PCC7424_1263
   00030 Pentose phosphate pathway
    PCC7424_1263
   00051 Fructose and mannose metabolism
    PCC7424_1263
   00052 Galactose metabolism
    PCC7424_1263
  Energy metabolism
   00680 Methane metabolism
    PCC7424_1263
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    PCC7424_1263
Enzymes [BR:cyc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PCC7424_1263
Protein phosphatases and associated proteins [BR:cyc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PCC7424_1263
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1399457..1400668
Genome map
AA seq 403 aa AA seqDB search
MSKKKRIGILTSGGDCPGLNAIIRAVVKAANRKNWEVYGLPYGTDGFIHLAKGLCTPDEL
RLTTHGYDLPGHLQGIDILQFLSGSILGSLSKGDPQDPEIAQSILDGYERLGLDALIAIG
GDGSLDIIYDLAQKGHWNFVAIPKTIDNDVPFTERSVGFDTAVDTVTHALYDLTFTAASH
ERVMIVQVMGRDAGHLALHAGIAGGADVILIPELVPHLSDQVVEGCCRQMADIRSTGRQF
ALIVLSEGVKNDNNGKEKYIGDYLANRINEQSHKLCENGLEEFCSLKNIDVRVTVLGHLQ
RSGTPSSSDRLIGTAFGIKAIELIEQEAYSRLVVWQHGGVYSQPLDQVIAVIRQCHRDNR
CAYPVDPDGFMVQTARSLNIYLGDQHLPLSDLDPKPTSFQLAV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaaaaaaacggattggaattttaaccagtgggggcgattgtcctggattaaat
gccattattcgggcagttgttaaagccgctaaccgaaaaaattgggaagtttatggatta
ccttatggaacagatggatttattcatctagcaaaaggtctttgtactcccgacgaactc
agattaaccactcatggttatgatctgcccggacatttgcaagggatagatattctgcaa
tttctgagtgggagtatcttaggttctctgagcaaaggagatcctcaagatccagaaata
gctcagtcaattttagacggatatgaacgcttagggctagatgctcttattgctattggt
ggggatggaagtttagatattatttatgacttagctcaaaaaggtcattggaattttgtc
gctattcccaaaaccattgataatgatgtccccttcaccgaacgctcagtcgggtttgat
acggcggtggatacggttactcatgctctttatgatctaacctttaccgccgcctctcac
gaacgggtaatgatcgttcaagtgatgggaagagatgccggacatttagcactccatgcc
ggtattgcagggggagcagatgtgattttaattcctgaattagtccctcatctctcggat
caggtggttgagggttgttgtcgccaaatggctgatattcgctcaactggtcgccaattt
gccttaattgttctctctgaaggggtgaaaaatgataataatggaaaagagaaatatatt
ggggattatttagccaatcgcattaacgaacaaagtcacaaattatgtgaaaacggacta
gaagaattttgttccctgaaaaatattgatgtacgagtgacggttttaggacacctacaa
cgtagcggaacgccttctagtagcgatcgcttaattgggacagctttcgggataaaagcc
atagaattaattgaacaggaagcctattctcgtcttgtggtttggcaacatggaggagtt
tatagtcaacccctcgatcaagtcattgctgtgattcgacaatgtcatcgagataatcgt
tgtgcttatccggttgatcccgatggatttatggtacaaaccgcccgatcgctcaatatc
tatctaggggatcaacatcttcctctaagtgatcttgaccctaaacccaccagttttcag
ttagcggtgtaa

DBGET integrated database retrieval system