KEGG   Cyanothece sp. PCC 7424: PCC7424_1263Help
Entry
PCC7424_1263      CDS       T00808                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:cyc01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cyc01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cyc00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:cyc00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cyc00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cyc00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:cyc00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1399457..1400668
Genome map
AA seq 403 aa AA seqDB search
MSKKKRIGILTSGGDCPGLNAIIRAVVKAANRKNWEVYGLPYGTDGFIHLAKGLCTPDEL
RLTTHGYDLPGHLQGIDILQFLSGSILGSLSKGDPQDPEIAQSILDGYERLGLDALIAIG
GDGSLDIIYDLAQKGHWNFVAIPKTIDNDVPFTERSVGFDTAVDTVTHALYDLTFTAASH
ERVMIVQVMGRDAGHLALHAGIAGGADVILIPELVPHLSDQVVEGCCRQMADIRSTGRQF
ALIVLSEGVKNDNNGKEKYIGDYLANRINEQSHKLCENGLEEFCSLKNIDVRVTVLGHLQ
RSGTPSSSDRLIGTAFGIKAIELIEQEAYSRLVVWQHGGVYSQPLDQVIAVIRQCHRDNR
CAYPVDPDGFMVQTARSLNIYLGDQHLPLSDLDPKPTSFQLAV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaaaaaaacggattggaattttaaccagtgggggcgattgtcctggattaaat
gccattattcgggcagttgttaaagccgctaaccgaaaaaattgggaagtttatggatta
ccttatggaacagatggatttattcatctagcaaaaggtctttgtactcccgacgaactc
agattaaccactcatggttatgatctgcccggacatttgcaagggatagatattctgcaa
tttctgagtgggagtatcttaggttctctgagcaaaggagatcctcaagatccagaaata
gctcagtcaattttagacggatatgaacgcttagggctagatgctcttattgctattggt
ggggatggaagtttagatattatttatgacttagctcaaaaaggtcattggaattttgtc
gctattcccaaaaccattgataatgatgtccccttcaccgaacgctcagtcgggtttgat
acggcggtggatacggttactcatgctctttatgatctaacctttaccgccgcctctcac
gaacgggtaatgatcgttcaagtgatgggaagagatgccggacatttagcactccatgcc
ggtattgcagggggagcagatgtgattttaattcctgaattagtccctcatctctcggat
caggtggttgagggttgttgtcgccaaatggctgatattcgctcaactggtcgccaattt
gccttaattgttctctctgaaggggtgaaaaatgataataatggaaaagagaaatatatt
ggggattatttagccaatcgcattaacgaacaaagtcacaaattatgtgaaaacggacta
gaagaattttgttccctgaaaaatattgatgtacgagtgacggttttaggacacctacaa
cgtagcggaacgccttctagtagcgatcgcttaattgggacagctttcgggataaaagcc
atagaattaattgaacaggaagcctattctcgtcttgtggtttggcaacatggaggagtt
tatagtcaacccctcgatcaagtcattgctgtgattcgacaatgtcatcgagataatcgt
tgtgcttatccggttgatcccgatggatttatggtacaaaccgcccgatcgctcaatatc
tatctaggggatcaacatcttcctctaagtgatcttgaccctaaacccaccagttttcag
ttagcggtgtaa

DBGET integrated database retrieval system