KEGG   Cyanothece sp. PCC 7424: PCC7424_1486Help
Entry
PCC7424_1486      CDS       T00808                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cyc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    PCC7424_1486
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PCC7424_1486
Enzymes [BR:cyc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     PCC7424_1486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1635176..1635718
Genome map
AA seq 180 aa AA seqDB search
MKVIPTEIPDVLIIEPKVFGDDRGFFYESFTEKVFKDKTEVDTHFVQDNHSRSLKNVLRG
LHYQIKQPQGKLVRVVLGEVFDVAVDIRSNSPTFGQWVGCRLSAENKRQLWVPEGFAHGF
LVLSEAAEFLYKTTDYYAPEYERTIIWNDPDIGIDWPIEDEPILSNKDQAGKLFKEADVF
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttattccgacggaaataccagacgttttgatcatagaacctaaagtcttcggg
gacgatcgaggttttttttatgaaagtttcaccgaaaaagtctttaaagacaaaacagaa
gtagacactcattttgtccaagacaatcattcccgttccctcaaaaacgtcttgagaggt
ttacattatcaaattaaacaacctcaaggaaaattagtaagagttgtactcggagaagtg
tttgatgttgccgtcgatatccgttctaactctccgacgtttgggcaatgggtcggctgt
agattaagtgctgaaaataagcgtcaattgtgggttcccgaaggatttgctcacgggttt
ttagttctatcagaggcagcagaatttttatataaaactactgattactatgccccagaa
tatgagagaaccattatttggaatgaccccgatatagggattgattggccgattgaagac
gaaccgattctatcaaataaggatcaagccggcaaactctttaaagaagcggatgtcttt
taa

DBGET integrated database retrieval system