KEGG   Cyanothece sp. PCC 7424: PCC7424_1521Help
Entry
PCC7424_1521      CDS       T00808                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K13491  
two-component system, chemotaxis family, response regulator WspF [EC:3.1.1.61]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:cyc00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PCC7424_1521
Enzymes [BR:cyc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     PCC7424_1521
Two-component system [BR:cyc02022]
 CheA family
  WspE-WspRF [MD:M00509]
   PCC7424_1521
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1675058..1676062)
Genome map
AA seq 334 aa AA seqDB search
MKIAIVNQTGTLLEFLRRTIATVPDYQIIWTATDGVQAISNSRANPPDLILMDMMRSNLD
GAKTTQEIMKQSPCPILMVTDSLKRDSSKIFEAMSYGALDVVHLPFLNSYHQSENSEILL
NKIAMIGTLTGLVRKRKRSLTPLCSLPFLVIIGASTGGPGAIAFLLSQLPVNFPAAIVVV
QHLDYQFVPDFVQWLDRQTPLTVLLAHEGNRPEIGKVLLAGSNDHLFLSPNLTLTYTQEP
LNYPFRPSVDVFFKSVAQHWHRKGIAILLTGMGKDGAQGLSQLREAGWHTIAQDQQSSVI
YGMPKAAVELNAATQVLSLEAISLTLLNRLTPYS
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagctatcgttaatcagacaggaactctccttgaatttttacgacgaacaatc
gctactgtgcccgattatcaaattatttggacggctactgatggagtgcaagctattagc
aattctagggctaatcctcccgatttaattttaatggatatgatgagatctaatctcgat
ggtgctaagacgactcaagagattatgaaacaatctccctgtcctattttaatggtaaca
gatagtttgaaacgagattcatctaagatttttgaagccatgagctatggcgctttagat
gtggttcatcttccttttttaaattcttatcatcagtcagaaaatagtgaaattttatta
aataaaattgcgatgattggcacattaaccggcttggttcgcaagcggaaacgatccctt
actcctctgtgttctcttccttttttggtcattattggtgcatccactggcgggcccggg
gcgatcgcttttttgttgtcccaattaccggttaattttcccgccgccattgtggttgtt
caacatctagattatcaatttgttcctgattttgtccaatggttggatcgtcaaactcct
ttaacggttttactcgctcatgagggaaatcgtccagaaattggtaaagttttgttagca
ggaagcaatgatcatctattcttaagccccaatttgacgttaacatatactcaagaacct
cttaattatcctttccgtcccagtgtagatgttttttttaaaagtgttgctcaacattgg
catcgcaaaggaattgctatactcttgactggaatgggaaaagatggggcccaagggtta
agtcagttacgggaagccggatggcatacgatcgctcaagatcaacaaagttctgtcatt
tatggaatgccaaaagcagcagttgaattaaatgcagcgactcaagttttatcccttgaa
gcgatctctttaaccctacttaatagactgactccctattcttaa

DBGET integrated database retrieval system