KEGG   Cyanothece sp. PCC 7424: PCC7424_1640Help
Entry
PCC7424_1640      CDS       T00808                                 

Definition
cyclic nucleotide-binding protein (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cyc00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cyc00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:cyc00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1815354..1817228)
Genome map
AA seq 624 aa AA seqDB search
MSSSELYYPQKVSTLDTSPILSCIVDIYERYRQINEGNVATYIPELAKVNPSLFGVCITT
ADGQVYEAGESQHCFTIQSISKPFVYGLALADHGCDVVMSKVGVEPTGEAFNSIVFDEVN
NRPYNPMVNAGAIATTALIKGDGYHQRFNRILTMFEGFAGRTLTVDEAVFESERATGHRN
RAIAYLELNAGMIDDPIDEHLDLYFRQCSILVTARDLAVMAATLANNGINPITKEQAIDS
QIVTSILSVMTSCGMYDFSGEWLYRIGLPAKSGVGGGIIAVLPGQFGIGTFSPLLDARGN
SVRGIRVCEDLSERFKFHVFNSHPIAETCITRHYTGAMVSSKRQRRAAERMILEQEGSQI
LVYELKGDLYFATMEKLARQLQQSPDTTKYIILEGRRLGNINTSALTLLCEMQKWLAIRD
IIVILTGFFPKILEALKEEGWPEETFFESSDTALEWCENDLLGKIAVKDGKLLEKLALGE
MDVFKDFSETELEVISSLFTSVVYQPNDLIIREGEEADHLFLLAAGVATVSLKLPHSEQR
KRLTTYIPGIAFGELALFDMNVTKRTADVIADTEVICYVLPLANLETLLITAPNVYVKLL
RSFGKTLVDTIKRATLEIRSLSLD
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcctcagagctatattatccccaaaaagtctcaactctagacacttcccctatt
ctctcttgtattgttgatatttacgaacgatatcgacagattaatgaggggaatgttgcc
acctatatcccagaactagctaaagtcaatcccagtctatttggggtttgtattaccacc
gcagatggacaagtctatgaagccggagagtctcaacattgttttaccattcaatctatt
tctaaaccttttgtgtatgggttagctttagcggatcatgggtgcgatgtggtgatgagt
aaagtcggggttgaaccgacgggagaagcttttaattctattgtatttgacgaagttaat
aaccgtccttataatccaatggtcaatgccggtgcgatcgccacaaccgctttaatcaaa
ggagacgggtatcaccagagatttaaccgtattctcacaatgtttgaggggtttgcgggg
agaactttaacggttgatgaggcggtgtttgagtcagaacgggcaaccggtcatcgtaac
cgggcgatcgcttatttagaattgaatgcagggatgatagatgatcccatcgatgaacat
ttagatctgtattttcgtcaatgttccattctagtaaccgcgagagatttagcggtaatg
gccgctactttagcgaataatggcatcaaccccatcactaaagaacaggccatagactct
caaattgtaacttctatccttagtgtaatgaccagttgcggaatgtatgatttttcggga
gaatggctctatcgcattggtttaccggctaaaagtggagtaggtgggggaattatcgcg
gttttaccgggacaatttggcattggaacgttttcaccccttttagatgccagggggaat
agtgtgcggggaatacgggtgtgtgaagacctttccgaacggtttaaatttcatgtcttt
aacagtcatcccattgcagaaacttgtatcacgcgccactataccggtgcaatggtttcc
tcaaaacgacaacgccgggcggctgaacggatgattttggaacaggaagggtcacaaatt
ctcgtctatgaactgaaaggggatctttattttgctacgatggaaaaattagcccggcag
cttcagcagtctccagacacaactaaatatattattctcgaaggtcgtcgtctgggcaat
attaacaccagcgccttaaccttactctgtgagatgcaaaaatggctggctattcgagat
attatcgtcattttaacgggatttttccctaagattttagaggcattaaaagaggaagga
tggccggaagaaactttttttgagagtagtgataccgctttagaatggtgtgaaaatgat
ttattagggaagatagcggtaaaagatgggaaacttttagaaaaactcgctttaggagaa
atggatgtttttaaagatttctctgaaacagaattagaggtcatttcttccctatttaca
tcagtggtttatcaacccaatgacttaattattcgggaaggagaagaagcggatcactta
tttttattagccgcaggagtggcaacggtttctttaaaacttccccatagtgaacaaaga
aaacggttaacgacttatattccggggatagcttttggagaattagcgttatttgatatg
aatgttactaaacgcacagcagatgttattgccgatactgaagttatatgttatgtgtta
cctttagccaatttagaaacattattaataactgctcctaatgtttatgttaaattactc
aggtcatttggtaaaactttagtcgataccataaaacgagcaactttagaaattcggagt
ttatccctagattaa

DBGET integrated database retrieval system