KEGG   Cyanothece sp. PCC 7424: PCC7424_2139Help
Entry
PCC7424_2139      CDS       T00808                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
cyc00010  Glycolysis / Gluconeogenesis
cyc01100  Metabolic pathways
cyc01110  Biosynthesis of secondary metabolites
cyc01120  Microbial metabolism in diverse environments
cyc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cyc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PCC7424_2139
Enzymes [BR:cyc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     PCC7424_2139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ACK70566
JGI: PCC74242139
UniProt: B7KG95
Position
complement(2390297..2391199)
Genome map
AA seq 300 aa AA seqDB search
MNIEQLNQNYAIEPHIKFIEHKSGFPLIEIDNTTAKAVISVYGGQVLSFQPKSHSDDLLF
VSNKAYYQQGKAIKGGVPICWPWFGPDPDSKGRPSHGFVRNRLSKVAQTQALSEETTKII
LSLSDTPDTREIWAHPFELSLSLTIGSSLTLELVTRNLCEQAVSITQGFHTYFKVGDINQ
VQVLGLDNTNYFDKVDGGQQKLQTGSVTIDSEVDRIYTSVGEKLTIEDPSLGRRLCITST
GSKSAVVWNPWEKISLQMGDLEDDDYKRFLCVETVNAATDVINIPSGGEYKLMANYTVES
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaatatagagcaattaaaccagaattatgctattgagcctcatatcaaatttatcgaa
cacaaaagcggttttcctctgatagaaatcgataacacaacagctaaagcggtcatctcg
gtctatgggggtcaagtgttgtcttttcaacccaaatcccactctgatgatcttttattt
gtgagtaataaagcctattatcaacaaggcaaagcgattaaagggggtgttcccatctgc
tggccttggtttggtccagaccctgattctaagggtcgtccgagtcatggttttgtccgt
aaccgtttatcgaaagttgctcaaactcaagctctatctgaagaaacaacaaagataatc
ttatccctaagcgatactcctgataccagagaaatttgggcacatccatttgagttatcc
ctatctttaactattggtagttcccttactttagaattagttacccgtaatctttgtgaa
caagctgtttccattacacaaggctttcatacttatttcaaagtaggagatattaaccaa
gtgcaagttttaggattagataataccaactattttgataaagttgatgggggtcaacaa
aaacttcaaacaggttcagttacaattgactctgaagttgatcgcatttacacttcagtt
ggagagaaattaacgattgaagatccgagtttaggtcgtcgtctttgcatcacttcaaca
gggagtaaaagtgctgtagtttggaatccttgggaaaaaatctccctacaaatgggggat
ttagaagatgacgattacaaaagatttttgtgtgttgaaaccgttaatgcagccacagat
gtaattaatattccatcagggggagaatataagttgatggctaattatactgtagaaagt
taa

DBGET integrated database retrieval system