KEGG   Cyanothece sp. PCC 7424: PCC7424_2164Help
Entry
PCC7424_2164      CDS       T00808                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
cyc00330  Arginine and proline metabolism
cyc00332  Carbapenem biosynthesis
cyc01100  Metabolic pathways
cyc01130  Biosynthesis of antibiotics
cyc01230  Biosynthesis of amino acids
Module
cyc_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:cyc00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PCC7424_2164
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    PCC7424_2164
Enzymes [BR:cyc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     PCC7424_2164
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ACK70588
JGI: PCC74242164
UniProt: B7KGB7
Position
complement(2411909..2413030)
Genome map
AA seq 373 aa AA seqDB search
MTKTIVVKIGTSTLTEPETGQLALSTIAALVETLTKLKTSGYQVVLVSSGAVGVGCGRLS
RKERPKDIAMKQAIAAVGQGRLIRVYDDLFNTLGQPIAQILLTRRELIDRRSYVNAYNTF
AALFELGVIPIVNENDTVAVEELNFGDNDTLSALVANLIEANWLFLLTDVDRLYSADPRL
VPTAQPITFVNPSDFAHLQVEAGSGGSGWGTGGMTTKLAAARIATSAGVRMVITHGRQPQ
NILKILEGEAIGTQFEPQPRTENARKRWIAYGLMPMGKLYLDEGAVKAICQGGKSLLPAG
IVRVEGDFVDSEAVLLCDGEGKEVARGLVNYKSTEIDKIKGYRSAQIALLLGYMGEETVI
HRDNLVISERKLS
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaacgatagttgttaaaattggcacttctaccttaacagaacccgaaaccgga
cagttagccctctccacgatcgccgccttggtagaaaccttaaccaagttaaaaacatca
ggttatcaagtggttttggtgtcttccggtgcggtgggggtagggtgtggacgacttagt
cgaaaagaacgtccgaaagatatcgccatgaaacaagcgatcgccgccgttggccaaggc
cgactaattcgggtttatgatgatttatttaacaccttgggacaaccgatcgcccaaatt
ttactgactcgacgagaactaatcgatcgccggtcttatgtcaatgcttataataccttt
gctgccctttttgaattaggggttattcccattgtcaatgaaaatgataccgtagcggtt
gaagagttgaattttggcgataatgatactctttctgctttggtggctaatttaattgag
gcaaactggttatttctcttaacggatgttgatcgcttatactctgccgatcctcgttta
gtccccacagcacaacctatcacttttgtcaaccctagtgattttgctcatttacaagtt
gaagcgggttctgggggttcgggttggggaactggaggaatgacgactaagttagccgcc
gcgcgaattgctaccagtgcaggggtaagaatggtaattactcatgggagacagccgcaa
aatattcttaaaattcttgagggagaagcgatcggaactcaatttgaaccccaaccccgc
acagaaaacgcccggaaacggtggatcgcttatgggttgatgccgatgggtaaattatat
ctcgatgaaggggcagttaaggccatttgtcaagggggtaaatctcttttaccggcggga
attgttcgggttgagggggattttgtcgattcagaggcggtattattgtgtgatggggag
ggtaaagaagttgccagaggtttagtgaattataagagtacagaaattgacaagattaaa
ggctatcgatcggctcaaattgctttacttttaggatatatgggcgaagaaaccgtaatt
catcgggataatttggtgatttctgagagaaagttatcttaa

DBGET integrated database retrieval system