KEGG   Cyanothece sp. PCC 7424: PCC7424_2254Help
Entry
PCC7424_2254      CDS       T00808                                 

Definition
carotene isomerase
Orthology
K09835  
prolycopene isomerase [EC:5.2.1.13]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
Carotenoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cyc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    PCC7424_2254
Enzymes [BR:cyc01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.13  prolycopene isomerase
     PCC7424_2254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2506049..2507569
Genome map
AA seq 506 aa AA seqDB search
MNLTDNITTDTDYDVIVIGSGIGGLVTATQLAAKGAKVLVLERYLIPGGSAGYFEREGYR
FDVGASMIFGFGTKGTTNLLTRALKAVNMSLDTIPDPVQIHYHLPDGLDLKVHRDYEKFI
EELTRHFPHEKEGIRRFYDECWKVFNCLNAMELLSLEEPRYLMRVFFQHPGACLGLVKYL
PQNTGDVARRYISDPKLLKFIDMECYCWSVVPANQTPMINAGMVFSDRHYGGINYPRGGV
GQIAQKLVDGLEKSGSEIKYQSRVTQILLKNGKAVGVKLANGQEYYAKRIVSNATRWDTF
EKLISPATLPTQERKWQKRYHKSPSFLSLHLGVKAEVLPPNTECHHILLENWQQMEDEQG
TIFVSIPTLLDPNLAPQGHHIIHAFTPSWIKHWQGLTPKDYQQKKEEAAGRIIERLEQIL
PGISQGLDYQEVGTPRTHRRFLGRVDGTYGPIPRYKLPGLLTMPFNRTSISGLYCVGDST
FPGQGLNAVAFSGFACGHRIGVDLGL
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaactgataatataacaactgacaccgactatgatgtcattgtaatcggctct
ggcattgggggattagtaacggctactcaactggcggccaaaggagcaaaagtgctagtc
ttagaacgttatctgattccggggggaagtgcgggatattttgaacgagaaggttatcgg
tttgatgtgggagcatcgatgatctttgggtttgggacaaaaggaacaactaacctcctg
actcgcgctcttaaagccgttaatatgagtttagacactattccggatccggtgcaaatt
cattatcatttaccagacggattagatttaaaagttcatcgagattatgagaaatttatc
gaagaattgacccgacattttccccatgaaaaagagggaattcgtcgtttttatgatgaa
tgttggaaagtatttaactgcttaaatgcaatggaattactttctttagaagaacctcgt
tatctgatgcgggtcttttttcagcatccgggagcttgtttagggttagtaaaatattta
ccgcaaaatacaggagatgtggcccgtcgttatattagcgaccctaaattactcaaattt
attgatatggaatgttattgctggtcggttgttcctgcgaatcaaactcccatgattaat
gcaggaatggttttttcagaccggcattatggaggaattaactatcctagagggggagta
ggacaaattgcccagaaattagtcgatgggttagaaaaatccggcagtgagattaaatat
cagtcgagagttacccaaattttgctaaaaaacggcaaagcagtcggagtaaaactcgcc
aatggtcaagaatattatgctaaacgaattgtttctaatgccactcgttgggataccttt
gaaaaattaatttctccggcaactctaccgactcaagagagaaaatggcaaaaacgttat
cataaatctcctagttttctaagtttacatttaggagttaaagcagaggttttacccccc
aataccgaatgtcatcacatcttactcgaaaattggcaacagatggaagatgaacaaggg
acaatttttgtgtctattcctaccttacttgacccgaatttagccccccaaggccatcat
atcattcatgcctttactcctagctggatcaaacactggcagggattaacccccaaagac
taccaacagaaaaaagaagaggcagccggacgcattattgaacgactagaacagattttg
cccggtatctcccaaggattagattatcaggaagtcggaacgccccgaactcatcgacgc
tttttaggacgagtcgacggcacttatggccccattcctcgctataaattacctggatta
ttgacaatgccttttaatcgcacctcgatttctggactctattgtgtcggagatagtacc
tttcctggtcaaggattaaatgctgtggctttttctgggtttgcttgtggtcatcgtatc
ggagttgacttaggactatag

DBGET integrated database retrieval system