KEGG   Cyanothece sp. PCC 7424: PCC7424_2273Help
Entry
PCC7424_2273      CDS       T00808                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
cyc00260  Glycine, serine and threonine metabolism
cyc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cyc01100  Metabolic pathways
cyc01110  Biosynthesis of secondary metabolites
cyc01130  Biosynthesis of antibiotics
cyc01230  Biosynthesis of amino acids
Module
cyc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cyc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PCC7424_2273
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PCC7424_2273
Enzymes [BR:cyc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PCC7424_2273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB TMP-TENI NanE DHO_dh Ribul_P_3_epim IGPS FMN_dh ThiG
Motif
Other DBs
NCBI-ProteinID: ACK70695
JGI: PCC74242273
UniProt: B7KHK0
Position
complement(2537386..2538210)
Genome map
AA seq 274 aa AA seqDB search
MMTNSISNRFKSLKARNQCAMIPFITAGDPDLETTAAALKILDRSGADFIELGVPYSDPL
ADGPVIQAAATRALQKGIQLDHVLDLVATVSPSLTAPIILFTYYNPILNRGIKNFMSQIA
QAGAKGLVIPDLPIDEASEVLEIAGSEGIEVILLVAPTSNDARIKAITEKSQGFIYLVSV
TGVTGMRSQIQGRVKTILSDIRHLTDKPIGIGFGIKSGEQAKELKEWGADAVIVGSAFVK
RLATDNPQEGLRAIEEFAHELKSAISQQSLVISH
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgatgactaattcaatttctaatcggtttaaaagtttaaaagctcgtaatcaatgcgcc
atgattccttttattaccgcaggggatccggatttagaaacaaccgcagccgccctcaaa
atattagaccgcagtggggctgattttatcgaattaggcgttccttacagcgatccttta
gcagacgggccggtgattcaagcggcggctactcgtgctttacaaaaagggattcaatta
gatcatgttttggatttagtggcaaccgtcagccctagcttaactgctccgattatttta
tttacttactataatcccatcttaaatcgaggcattaaaaattttatgtctcaaattgct
caggcaggggctaaagggttagtcatccccgatctacctatagatgaagcaagtgaggta
ttagaaatcgcggggagtgaaggaattgaggttattttgttggtcgctccgacttctaat
gatgcaagaattaaggcgatcaccgaaaaatcccaagggtttatttatctagtcagcgtc
acgggtgtaacgggaatgcgttctcaaattcagggacgagtcaaaacaatactttctgac
atacgccatttgactgataaaccgatcggcattgggtttgggattaagagcggtgaacag
gccaaagaattgaaggagtggggcgcagatgcggttattgttgggagtgctttcgttaag
cgcttggcaacggataacccccaagaaggtcttcgagcgattgaagagtttgcccatgaa
ctaaaatctgccattagtcagcagtcattggttattagtcattag

DBGET integrated database retrieval system