KEGG   Cyanothece sp. PCC 7424: PCC7424_2333Help
Entry
PCC7424_2333      CDS       T00808                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cyc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PCC7424_2333 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PCC7424_2333 (glk)
   00052 Galactose metabolism
    PCC7424_2333 (glk)
   00500 Starch and sucrose metabolism
    PCC7424_2333 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    PCC7424_2333 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PCC7424_2333 (glk)
   00524 Butirosin and neomycin biosynthesis
    PCC7424_2333 (glk)
Enzymes [BR:cyc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PCC7424_2333 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2601291..2602352
Genome map
AA seq 353 aa AA seqDB search
MTILLAGDIGGTKTILRLVQSDPTETLKELPKQTTLWEDTYPSQNFPDLVPIVRKFMQEA
TDKLAQTLTIEQACFGIAGPVVDNTSELTNLSWSLSGDRLAKELNINKVSLINDFAAIGY
GVIGLTSDDICTLQEGERDSHAPIAILGAGTGLGEGYLIPLSDGSYRVCPSEGSHADFPP
RSTTEFQLLNYIREHYNIDRVSVERVVSGQGIVTIYEFLRHQDPSQESSYFAPIYQAWER
ELGKGLKTIDLAAEISKAATEQSDYLCQQTMKLFLEAYGAEAGNLCLKLLPYGGLYVAGG
ITAKNIALMQQGNFMKAFSHKGRVSPLLRKIPVHLVLNPKVGLIGAALRAAQL
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaccattttactggccggagatatcggcggaacgaaaacgatcctcagattagtccaa
tcagacccaacagaaaccctaaaagagttacctaaacagactacactatgggaagatacc
tatcctagtcaaaatttccctgatttagtgccgattgttcgtaaattcatgcaagaggca
acggataagttagctcaaactctcacgatcgaacaagcttgttttggcattgctggccct
gtggttgataatacctcagaattgactaacctcagttggtcgttatccggcgatcgcctc
gctaaagagcttaatattaataaagtgagtctgattaatgattttgctgccatcggttat
ggagtaataggactcacctcagatgatatctgtactttacaagagggagaaagagattct
catgctcccattgctattttaggggcaggaacagggttaggagaaggatatttaattcct
ttgtcggatggaagttatcgggtttgtcctagtgaaggttctcatgcggactttcctcct
cgctctactacagagtttcaactgcttaattatattcgggaacactataatatagaccgg
gtatctgttgaacgagtggtttctggccagggaattgtcacgatttatgagtttcttcgt
catcaagatccctctcaagaatcctcttattttgccccaatttatcaagcttgggaacgg
gaattaggtaaagggttaaaaacgatagatttagccgcagaaatttctaaagccgccaca
gaacaaagtgattatttgtgccaacaaacgatgaaattatttctagaagcttatggggca
gaagccgggaatttgtgcttaaaattattgccctatggcgggttatatgttgccggtgga
attacggctaaaaatatcgctttaatgcaacagggcaattttatgaaagctttttcacat
aaaggaagagttagccccttactcagaaaaattccggttcatcttgttcttaaccctaaa
gtgggtttaattggggcggctttacgggcagcacaactttaa

DBGET integrated database retrieval system