KEGG   Cyanothece sp. PCC 7424: PCC7424_2353Help
Entry
PCC7424_2353      CDS       T00808                                 

Definition
(RefSeq) phosphoglyceromutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cyc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PCC7424_2353
   01230 Biosynthesis of amino acids
    PCC7424_2353
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PCC7424_2353
  Energy metabolism
   00680 Methane metabolism
    PCC7424_2353
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PCC7424_2353
Enzymes [BR:cyc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PCC7424_2353
Exosome [BR:cyc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PCC7424_2353
  Exosomal proteins of melanoma cells
   PCC7424_2353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2622852..2623553)
Genome map
AA seq 233 aa AA seqDB search
MSKLILIRHGQSLWNAANKFTGWVDIPLSRRGRAEAMIAASKLQEQGYRIDVCFTSLLIR
AMETAIIALTEYEQLCGGKTPIFKHDADDLDWHGWDKYDGDPKEELPIFPSQALDERYYG
DLQGLNKAQTAQKYGSEQVHEWRRSYFTRPPGGESLEDTQKRVIPYFENRILTHIAHGDT
VMVAAHGNSLRAMIMRLENLQPEDVPNLELATGIPLIYEVDQQAKVSNKIVLH
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaactaatactgattcgacatggccaaagtctttggaatgccgccaataaattc
accggttgggtagacattcccctcagtagaagaggtcgagcagaagcaatgattgccgct
agtaaacttcaagaacaaggatatcggattgatgtgtgttttactagcctgttaattcga
gcgatggagacagctattattgctctcaccgagtatgaacaactttgtggcggaaaaacc
cctatttttaaacatgatgctgatgatcttgactggcatggttgggataaatatgatgga
gatcctaaagaagaactgccgatttttccctctcaagctttagatgagcggtattatgga
gatttacagggactcaataaagcacaaaccgcgcaaaaatacggctctgaacaagttcat
gaatggcggcgctcatactttacccgtccacccggaggagaaagtttagaagatactcaa
aagcgagtcatcccttattttgaaaatcgtattttaacccatattgctcacggcgataca
gttatggttgctgctcatggaaattctttgcgagctatgattatgagattagaaaacctc
cagccggaagacgttcctaatttagaactcgccaccggaattcctctcatttatgaagtg
gatcaacaagctaaagtcagcaataaaatcgttttacattaa

DBGET integrated database retrieval system