KEGG   Cyanothece sp. PCC 7424: PCC7424_2353Help
Entry
PCC7424_2353      CDS       T00808                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
cyc00010  Glycolysis / Gluconeogenesis
cyc00260  Glycine, serine and threonine metabolism
cyc00680  Methane metabolism
cyc01100  Metabolic pathways
cyc01110  Biosynthesis of secondary metabolites
cyc01120  Microbial metabolism in diverse environments
cyc01130  Biosynthesis of antibiotics
cyc01200  Carbon metabolism
cyc01230  Biosynthesis of amino acids
Module
cyc_M00002  Glycolysis, core module involving three-carbon compounds
cyc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cyc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PCC7424_2353
  Energy metabolism
   00680 Methane metabolism
    PCC7424_2353
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PCC7424_2353
Enzymes [BR:cyc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PCC7424_2353
Membrane trafficking [BR:cyc04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    PCC7424_2353
Exosome [BR:cyc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PCC7424_2353
  Exosomal proteins of melanoma cells
   PCC7424_2353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 Sortase
Motif
Other DBs
NCBI-ProteinID: ACK70774
JGI: PCC74242353
UniProt: B7KIT8
Position
complement(2622852..2623553)
Genome map
AA seq 233 aa AA seqDB search
MSKLILIRHGQSLWNAANKFTGWVDIPLSRRGRAEAMIAASKLQEQGYRIDVCFTSLLIR
AMETAIIALTEYEQLCGGKTPIFKHDADDLDWHGWDKYDGDPKEELPIFPSQALDERYYG
DLQGLNKAQTAQKYGSEQVHEWRRSYFTRPPGGESLEDTQKRVIPYFENRILTHIAHGDT
VMVAAHGNSLRAMIMRLENLQPEDVPNLELATGIPLIYEVDQQAKVSNKIVLH
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaactaatactgattcgacatggccaaagtctttggaatgccgccaataaattc
accggttgggtagacattcccctcagtagaagaggtcgagcagaagcaatgattgccgct
agtaaacttcaagaacaaggatatcggattgatgtgtgttttactagcctgttaattcga
gcgatggagacagctattattgctctcaccgagtatgaacaactttgtggcggaaaaacc
cctatttttaaacatgatgctgatgatcttgactggcatggttgggataaatatgatgga
gatcctaaagaagaactgccgatttttccctctcaagctttagatgagcggtattatgga
gatttacagggactcaataaagcacaaaccgcgcaaaaatacggctctgaacaagttcat
gaatggcggcgctcatactttacccgtccacccggaggagaaagtttagaagatactcaa
aagcgagtcatcccttattttgaaaatcgtattttaacccatattgctcacggcgataca
gttatggttgctgctcatggaaattctttgcgagctatgattatgagattagaaaacctc
cagccggaagacgttcctaatttagaactcgccaccggaattcctctcatttatgaagtg
gatcaacaagctaaagtcagcaataaaatcgttttacattaa

DBGET integrated database retrieval system