KEGG   Cyanothece sp. PCC 7424: PCC7424_2353Help
Entry
PCC7424_2353      CDS       T00808                                 

Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cyc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PCC7424_2353
   01230 Biosynthesis of amino acids
    PCC7424_2353
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PCC7424_2353
  Energy metabolism
   00680 Methane metabolism
    PCC7424_2353
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PCC7424_2353
Enzymes [BR:cyc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PCC7424_2353
Exosome [BR:cyc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PCC7424_2353
  Exosomal proteins of melanoma cells
   PCC7424_2353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2622852..2623553)
Genome map
AA seq 233 aa AA seqDB search
MSKLILIRHGQSLWNAANKFTGWVDIPLSRRGRAEAMIAASKLQEQGYRIDVCFTSLLIR
AMETAIIALTEYEQLCGGKTPIFKHDADDLDWHGWDKYDGDPKEELPIFPSQALDERYYG
DLQGLNKAQTAQKYGSEQVHEWRRSYFTRPPGGESLEDTQKRVIPYFENRILTHIAHGDT
VMVAAHGNSLRAMIMRLENLQPEDVPNLELATGIPLIYEVDQQAKVSNKIVLH
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaactaatactgattcgacatggccaaagtctttggaatgccgccaataaattc
accggttgggtagacattcccctcagtagaagaggtcgagcagaagcaatgattgccgct
agtaaacttcaagaacaaggatatcggattgatgtgtgttttactagcctgttaattcga
gcgatggagacagctattattgctctcaccgagtatgaacaactttgtggcggaaaaacc
cctatttttaaacatgatgctgatgatcttgactggcatggttgggataaatatgatgga
gatcctaaagaagaactgccgatttttccctctcaagctttagatgagcggtattatgga
gatttacagggactcaataaagcacaaaccgcgcaaaaatacggctctgaacaagttcat
gaatggcggcgctcatactttacccgtccacccggaggagaaagtttagaagatactcaa
aagcgagtcatcccttattttgaaaatcgtattttaacccatattgctcacggcgataca
gttatggttgctgctcatggaaattctttgcgagctatgattatgagattagaaaacctc
cagccggaagacgttcctaatttagaactcgccaccggaattcctctcatttatgaagtg
gatcaacaagctaaagtcagcaataaaatcgttttacattaa

DBGET integrated database retrieval system