KEGG   Cyanothece sp. PCC 7424: PCC7424_2396Help
Entry
PCC7424_2396      CDS       T00808                                 

Definition
stearoyl-CoA 9-desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:cyc01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:cyc01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2670783..2671631
Genome map
AA seq 282 aa AA seqDB search
MTSNFTQAPVDGEQSLKLHWVSIMFFGAAHLLALLAPWFFSWSALGVMLFFHWLTGSIGI
CLAYHRLLSHHSFQVPKWLEYILAMIGALALQGGPIFWVAGHRLHHAHTEDIDLDPYSAR
RGFWWSHILWLFYDRKEFFDYETYKRFAPDLARDPFYRWLNQYYLFLQIPLGLLLYVIGG
WSFVIYGIFLRAVMLWHCTWLINSATHMWGYRTFNSEDNSRNLWWAALLTYGEGWHNNHH
AHPHVVKAGLKWWEIDMTWWAVQALKSLGLAKKLVLPSVKRA
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgacatcgaattttacccaagctcccgttgatggggagcagtcgctcaaactacattgg
gttagtataatgttttttggagcggctcacctgctggctttattggccccttggtttttt
tcttggtctgccctaggtgtaatgctatttttccattggcttaccggtagcattggcatt
tgtttagcctatcaccgtctcctgagtcatcacagttttcaagttcctaaatggctggag
tatattttggcgatgattggggcactggccttacaaggagggccgatcttttgggttgcg
ggacaccgcttacaccatgctcacaccgaagatattgacctagatccttactcagcccga
cgcggcttttggtggagtcatatcctctggttattttatgaccgtaaagaattttttgat
tacgaaacttataagcggtttgctcctgatttagcacgagatcctttttaccgttggctt
aatcaatactacttattcctccagattcctttaggattattactgtatgtgattggcggt
tggtcttttgtcatttatggcatatttttaagagcagttatgctttggcattgcacctgg
ttaatcaactcggctactcatatgtggggttatcgcaccttcaactcggaagataactct
cgtaatctttggtgggctgctcttcttacttatggggaaggctggcataataatcatcac
gctcatcctcatgtagtcaaagctggcttaaaatggtgggaaattgatatgacttggtgg
gcagttcaagctttaaaaagcttgggtttagccaaaaagcttgtacttccctcggtaaaa
agagcataa

DBGET integrated database retrieval system