KEGG   Cyanothece sp. PCC 7424: PCC7424_2403Help
Entry
PCC7424_2403      CDS       T00808                                 

Definition
helicase, RecD/TraA family (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cyc03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2677531..2679774)
Genome map
AA seq 747 aa AA seqDB search
MNLRDSCVPYRCPTPESLTGVVERITYHAEESGYTVARIQCPRAKELVTVVGNFANIQAG
QTLQLKGIWKNHPQYGQQFEVQQYTETKPATLTGMEKYLGSGLIKGLGPVMARRIVAHFG
LETLEIIENKTERLIEVPGIGKKRVVMIQKAWATQKAIKEVMVFLQGHGVSTAYAVKIFK
QYGQNAIATVTDNPYQLADDIYGIGFLTADKIAQNVGVSPWSKYRYKSGLLHVLSQAAED
GHCFLPQPELMKLGAEILSNGGHQAEIEAISAIIEEMGQQQALMVEKGEGGMPLCYKPAF
FYTEENLAQLLRQQLSLPVEVDLPRVRNWIERFTQSRGISLSPQQQQAVEMAVSSRIMVL
TGGPGTGKTFCTRTIVALWKAMGKKIGLAAPTGRAAQRMGEVTGLEAKTLHRMLEFDPST
MGFKRDKDNPLPYDALVVDETSMLDLFLAHSLLKAIASGACLLLVGDRDQLPSVGPGKVL
ADLIDSGKIPIVRLSVVFRQASQSAIIRAAHQINEGQYPYLEPISDPAKSDCLWHNGGTE
PEHGVQVVCELIRDFIPRQGFNPLTDVQVLCPMTRGAVGTRNFNQVLQQLINPPSPDKAE
VSTRGMTFRVGDRVIQLKNDYEREVFNGDLGRVWAIDPVEQELTICFDGRDVVYDFADLN
EIALAWSISIHKSQGSEYPVVLLPIYTSHYIMLSRNLIYTGLTRAKKLAIIIGSSKAIGM
AVRQVNQQERYTRLKERLGVKLMEVWR
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgaatctaagagactcctgtgtaccttatcgatgtccaactcctgaatcgcttaccggc
gtggtagaacgcattacctatcacgccgaagaatcgggttataccgtcgctcggatacaa
tgccccagagcaaaggaattggtgacggtagtgggcaactttgccaatattcaagccgga
cagactcttcaactcaagggaatctggaaaaatcacccccaatacggacagcagtttgag
gttcagcaatacactgaaaccaaaccggccacactcacgggcatggagaaatatttgggc
agtggcttaataaaaggacttggcccagtaatggccagacgaatcgtagcccactttggg
ctagaaaccctagaaatcatcgaaaataagaccgaaaggctgattgaagtcccaggcatc
ggcaaaaagcgcgttgtcatgattcaaaaggcttgggctacccagaaagctatcaaagaa
gtcatggttttcttgcagggacatggggtttctactgcttacgccgttaaaatctttaag
cagtacggacaaaatgcgatcgccaccgttaccgataatccctatcaactcgccgatgat
atttatgggatcggttttttgacagccgataaaattgcccagaatgtaggggtgtctccc
tggtcaaaatatcgctacaaatcgggtcttctgcacgttttaagccaagccgccgaggac
ggacattgttttttacctcaaccagaattgatgaagctaggagcggaaattctcagtaat
gggggacatcaagccgaaatagaagcgattagtgccattattgaggagatggggcagcaa
caagccttaatggtggaaaaaggagagggggggatgcctttatgctacaaaccggctttc
ttttatactgaagaaaaccttgctcaattactgcgacaacaactttcactaccggttgaa
gtggatttaccccgtgttaggaattggatagaacgttttactcaaagtcgggggatttct
ctttctccccaacagcaacaagcggtagaaatggccgtttcttcacggataatggttctc
acaggggggccaggaacgggaaaaaccttttgtacccgtactattgtagctttatggaag
gcgatggggaagaaaatcgggttagccgctcccaccggacgggcagcccagagaatggga
gaggtgacgggtttagaagctaaaactctccacagaatgctcgaatttgacccgtccacg
atgggatttaaacgagataaagacaatcccctgccctacgatgctttagtggtagatgaa
acttcgatgctggacttgtttctggctcattcgttgttaaaagcgatcgcatcgggggct
tgtttattgttagttggtgaccgggatcaattgcccagtgtggggccaggaaaagtttta
gccgacttgattgattcggggaaaattcctatcgtgcgtctgtcagtagttttccgacaa
gcttcacagagtgctattattcgggcggcacaccaaattaatgagggtcaatatccctac
ttagagccgattagcgaccctgctaaatcagattgtctgtggcacaatgggggaactgag
ccagaacatggggttcaagttgtatgtgaactgatccgtgatttcattcctcgtcagggt
tttaatcccctaacagatgtacaggtattatgtcccatgacaaggggagcagtggggaca
cgcaattttaaccaagtgcttcagcaattaattaaccctccaagtcccgataaagccgaa
gtttccacaagggggatgacttttcgagtgggagatagagtgattcaactgaagaatgat
tatgagagagaagtgtttaatggagatttagggagagtatgggctattgatccagttgaa
caagaactaactatctgctttgacgggcgagatgtggtttatgattttgctgacctcaat
gaaatagctttagcttggtcgatttccatccataaaagccaagggtcagagtatccagtc
gttttgctgccgatttacaccagtcattatataatgctctctcgaaatctcatttacact
gggctaactcgtgctaagaagttagcaattatcattgggtcttctaaagcaatagggatg
gccgtaaggcaagtgaaccaacaggagcgttatacaaggctcaaagagcgcttaggggtt
aaattaatggaagtgtggcgatag

DBGET integrated database retrieval system