KEGG   Cyanothece sp. PCC 7424: PCC7424_2502Help
Entry
PCC7424_2502      CDS       T00808                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cyc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PCC7424_2502
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PCC7424_2502
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PCC7424_2502
Enzymes [BR:cyc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PCC7424_2502
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2783551..2784684)
Genome map
AA seq 377 aa AA seqDB search
MVIQKLTPKPPINSSSSVDTPPNSDFKPWRGLIETYRPYLPVTDATPVITLLEGNTPLIP
VPYISQQIGKGVKVLVKFDGLNPTGSFKDRGMTMAISKAKEEGAKAVICASTGNTSASAA
AYARRAGMRAFVIIPDGYVAMGKLAQALVYGAEVIAIEGNFDDALKIVRGLSENYPVTLV
NSINPYRLEGQKTAAFEVVDTLGNAPDWLCIPVGNAGNISAYWMGFCQYHQQGKCDRLPK
MMGFQAAGAAPFILGQPVPHPETIATAIRIGNPANWDKALGVKEASQGEFNRVTDEEILE
AYRLLAAQEGIFCEPASATSVAGLLKVKDQVPAEATVVCVLTGNGLKDPDAAINNCNNQV
KAGITPDLSVVAKVMGF
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggtaatccaaaaattaacacctaagcctcctattaatagttcatcctctgtcgatact
ccccccaactcagactttaaaccctggcgaggcttaatcgaaacctatcgcccctatctc
cctgtcaccgacgcaacccccgttattacccttctcgaaggaaataccccccttatcccc
gttccctacatttctcaacaaattggcaaaggggtcaaagttttggtcaaatttgacggg
ttaaaccccaccggtagctttaaagaccgagggatgacaatggctatctcaaaagccaaa
gaagaaggggcaaaagcggttatctgtgccagtaccggcaacacatccgcctcggctgct
gcctatgcccgtcgcgccggaatgcgggcttttgtgattattcccgacggatacgtggct
atgggaaaacttgcccaagctttagtctatggggcagaagtgattgctattgaggggaat
tttgatgatgcccttaaaatcgtgcggggattatcggaaaattatcccgttactctggtt
aattctatcaacccctaccgtttagaaggacaaaaaaccgccgcctttgaagtagtagat
accctaggaaatgcccccgactggttatgtattccggtgggaaatgccggcaatattagc
gcctattggatgggcttttgtcaatatcatcaacagggaaaatgcgatcgcttaccaaaa
atgatgggctttcaagccgccggtgctgcgccttttattttagggcaacctgtcccccac
ccagaaacgatcgccacggccatccgcatcggcaacccggccaattgggataaagctttg
ggagtcaaagaagccagtcaaggggagtttaaccgagttacggatgaagaaatattagaa
gcttatcgccttttagcagcgcaagaaggaatattttgtgaaccggctagtgctacatct
gtggcaggattattaaaggtaaaggatcaagttccagccgaggcaacggtggtttgtgtg
ttaaccggtaatggattaaaagatccagatgcggcgattaataactgtaataatcaagtt
aaagcaggaattacccctgatttatccgtagttgccaaagtaatgggtttttaa

DBGET integrated database retrieval system