KEGG   Cyanothece sp. PCC 7424: PCC7424_2689Help
Entry
PCC7424_2689      CDS       T00808                                 

Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
cyc00340  Histidine metabolism
cyc01100  Metabolic pathways
cyc01110  Biosynthesis of secondary metabolites
cyc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cyc00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    PCC7424_2689
Enzymes [BR:cyc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     PCC7424_2689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ACK71101
JGI: PCC74242689
UniProt: B7KKY2
Position
2973214..2974515
Genome map
AA seq 433 aa AA seqDB search
MVRILKLAQMSASELATLKKRAELDIDNALSIAKTVIDKIKQDGDTGVIEYVRKFDYPEA
TVDTIKVTPQEFAQAHELIEPDVKTAIEQSFKNIKEVHQRQMPEEIQLAEIEKGVFAGEK
ISPLPSAGLYVPRGRGAFPSMMLMLAIPAQVAGVKNIVVCTPPDKQGKVEPASLVAASMA
GVTEIYKLGGVQAIAAMALGTQSIPKVDKVTGPCSVYGAAAKRLLFGTVDVGLPAGPSES
IILADESTNPQLAALDLLIEAEHGSDSAALLVTHSETVAEKASRYVDEYLEKLPQWRRQY
CEDGLSAYGGIILTSSLEESLNFINDYAPEHLEVLVKDPFNVIGQIHNAGEILLGSHTPS
SMATYAIGVNAVLPTGGFARSYSAVSVFDFLKRSTLAYVTPDGFETLKQTTITLADYEGF
PAHGLAIRERENL
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
gtggttagaattcttaaactcgcccaaatgtcagcgtcagaactcgccacgttaaaaaaa
cgggcagaattagatatcgataatgcgctctcgatcgctaaaactgttattgataaaatt
aaacaagatggagacaccggagtcattgagtatgtgagaaaatttgactacccagaggca
accgtagacacgatcaaagtaactccccaagaatttgctcaagcacatgagttaattgaa
cctgacgttaaaaccgccatcgaacaatcttttaaaaatattaaagaggttcatcagcgt
caaatgccagaagaaattcaactggcagaaattgaaaaaggagtctttgccggggaaaaa
atttctcccctccctagtgccgggttatatgttcctagaggcagaggcgctttcccctcc
atgatgctaatgttggctattccggctcaggtagccggagtgaaaaatattgtcgtctgt
accccccccgataaacagggaaaggtagaaccggcctccctcgtagcggcttctatggca
ggagtcacagaaatttataaactcggaggagttcaggcgatcgcagcgatggcgttggga
actcaatctatccccaaagtcgataaagtaacggggccttgtagtgtttatggagcagcc
gccaaacgccttttatttggaacagtggatgtgggactaccggcagggccaagtgagtct
attattttagccgatgagtctactaatcctcaattagccgccctagatttattaattgaa
gcagaacatggttcggactctgccgctttgttagtcacgcatagtgaaaccgtagccgaa
aaagcgagtcgttatgtggatgaatatctggaaaaattacctcaatggcgcagacaatac
tgtgaagatgggttatcggcctatggggggattattttaacctctagcttagaagaatct
cttaattttattaatgattatgccccagaacatttagaagttttagttaaagatcccttt
aatgtgatcggacaaattcacaatgctggggaaattttattaggatctcacactccctca
tcaatggcaacctatgcgatcggcgttaatgccgtgctgccgacgggagggtttgcccgg
tcttattctgcggtgtctgtatttgattttctcaagcgttcaaccttagcttatgtgact
cccgatgggtttgaaactttaaagcaaactaccataacgttagctgattatgaaggcttt
cccgctcatgggttagccattagagaacgggaaaatttgtag

DBGET integrated database retrieval system