KEGG   Cyanothece sp. PCC 7424: PCC7424_2696Help
Entry
PCC7424_2696      CDS       T00808                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:cyc00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PCC7424_2696
Enzymes [BR:cyc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     PCC7424_2696
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2983726..2984643
Genome map
AA seq 305 aa AA seqDB search
MLLDSTPAVQQFLGSEQITPYSSAKVVILPIPYEATTTYRKGCENGPGAVLEASQQLEAY
DEELEQETCIDVGIYTHSPIADTRYQFFSAEEMLHLTKETVSHLINDNKFVVAVGGEHAI
TTGVVQAYLETLKEPFTVIQIDAHGDMRSSFEGSIHNHACVMRRVLEMGLPTLPVGIRSI
CSEEAQLIKEKQIPVIWGRDIATGPDWIETAIARIPTEKVFITIDVDGIDPALIPGVGTP
EPGGMGWYETLNFLKRVCQTHQVIGCDVMELAPVADSVVSEFTTAKLIYKLIGYVANSQN
WQQTN
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgcttctagactcaactcctgcggtacaacaatttttaggctcagaacaaattaccccc
tattcatcagcaaaagtcgttatattacctattccctacgaagcgactacgacttatcga
aaaggatgtgaaaatggccctggtgcagtgctagaagcctctcaacaattagaagcttat
gacgaagaattagagcaagaaacttgtattgatgtaggaatttatactcattctcctatc
gcggatactcgttatcagttcttctctgccgaagaaatgttacacctaacgaaggaaacc
gtctcacatttaattaacgataataaatttgtcgttgctgtaggaggagaacacgctatt
actacaggagtcgtgcaagcttatctggaaaccctaaaagaaccctttaccgtcattcaa
atagacgctcatggggatatgcgctctagttttgaaggttcaatccataatcacgcttgt
gtcatgagacgggtgttagaaatgggtttaccgacactccccgtcggcattcgcagtatt
tgttccgaagaagcacagttaattaaagaaaaacaaattcccgttatttggggtagagat
atcgccactgggcccgactggatagaaaccgcgatcgctcgtattcccaccgaaaaagtg
tttattaccattgatgtagatggaatagatccagctttaattcctggggtaggcactccg
gagccggggggaatgggatggtacgaaaccctaaactttttaaaaagagtctgtcaaacc
catcaagtgataggctgtgatgtgatggaattagctcccgtagcagattcagtagtttcc
gagtttacaaccgccaaattaatctataaattaatcggctatgtagccaatagtcaaaat
tggcaacaaactaactaa

DBGET integrated database retrieval system