KEGG   Cyanothece sp. PCC 7424: PCC7424_2742Help
Entry
PCC7424_2742      CDS       T00808                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:cyc00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cyc00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3035089..3036120)
Genome map
AA seq 343 aa AA seqDB search
MMNPSIHERVSPIMTFTWTRNHILALADWVPAEYEILLQTASSFREVLSRRTKKVPALQG
QVVANLFFEPSTRTRSSFELAAKRLSADILNFSPGTSSLTKGETILDTAKTYLAMGANIM
VIRHQQAGVPLAIATEMDRLDTGVSILNAGDGQHEHPSQGLLDLFTICSLLDAENPSIER
LKSKKIAIVGDILHSRVARSNIYSLTTAGAEVHLAGPPTLVPHLFAGMINPKNEGKLFIH
WEIEPALSDADFVMTLRLQRERMTNHLLPSLREYHLRYGITRDRLKLCKDEVRVLHPGPV
NRGVELSSDLMDDPRVSLISTQVTSGVAVRMALLYLIADLDTQ
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatccctcaattcatgagagagtgtcaccaattatgacctttacttggactcgt
aatcacattttagcgctggcagattgggttccggcggaatacgaaattttattacaaact
gcctctagtttccgagaagttttatcccgacggacgaaaaaagtccccgcccttcaagga
caagtcgtggctaacctcttttttgaaccctctacccggactcgcagcagttttgaatta
gctgctaaacgcttatctgccgatattctcaatttttcgccgggaacgtcttccctgact
aaaggggaaaccattttagacaccgctaaaacttacttagcgatgggagcaaatattatg
gttattcgtcatcaacaggcaggagttcccctagcgatcgcaacagaaatggatcgtctt
gatacaggggtaagtattctcaatgccggcgatggacaacatgaacatccctctcaaggg
ttgttagatttatttactatctgctcacttttagatgctgaaaatccgagcatagagcga
ttaaaatcgaaaaaaattgcgatcgtgggggatattttgcattctcgcgtcgcccgttct
aatatttatagtttaaccactgccggggccgaggtccatttggctggccctcctacctta
gttccccatttatttgccggcatgattaatcctaaaaatgagggtaaattattcattcat
tgggaaattgagccggctttatccgatgcagattttgtgatgacattacgtctacaacgg
gaaagaatgactaaccatcttttaccgagtttacgagaatatcatctccgttatggcata
acccgcgatcgtctcaaactatgtaaagatgaggttagggtacttcatccggggccggtt
aaccgaggtgtagaattaagttcagatctaatggatgatccgcgcgtgagtttaatttca
actcaagtcactagcggggtagctgtgcggatggctttattatatttaattgccgatctc
gacactcaataa

DBGET integrated database retrieval system