KEGG   Cyanothece sp. PCC 7424: PCC7424_2921Help
Entry
PCC7424_2921      CDS       T00808                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cyc00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3251257..3252756
Genome map
AA seq 499 aa AA seqDB search
MNFERSSGIILQPTSLPSRFGIGDLGKSAYQFIDFLERSGQTLWQILPLGPTGYEHSPYT
MNYSAFAGNPLMISLENLVEDGLLKADELTPLPHSDEDDPNLVNFNRVIPHKTQFLKLAY
SRFEVTPEYEQFCQEQSEWLEDYALFMALLEENEGKNWNQWERAIALREPEAIKTTTETL
KDAINYHKFLQFKFFQQWKALRTYANNKNIKIIGDISIYVCYNSADVWANPQCFKLDPQT
LEKTYIAGVPPDYFSATGQLWGNPVYNWDYLQKTNYEWWFKRFKATLQYADFVRVDHFRG
FEAYWQVPAGEETAINGEWIKAPGEDFFEKLKHHLGSLPVLAEDLGIITPEVEELRDRFD
FPGMRILLFAFDGDTNNPYLPHHYVKNCAVYIGTHDNDTAIGWWEKASHEEKQRVADYLG
YSSPEEIKEINWVLLRLGFASVANLAIVQLQDILGLDNRARMNDPSKNEDNWRWRYTSSD
LLTQELSDRVQKITQLYSR
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgaacgctctagtgggattatcctgcaaccaactagcttacctagtcgtttt
ggcattggggatttaggaaaatcagcttatcaatttattgattttctagaacgaagtggt
caaacgttatggcagattctaccccttggccctacagggtatgaacattctccctatacc
atgaattatagtgcttttgcgggcaatcctttaatgattagtctggagaatcttgtcgag
gatggtttgcttaaagcggatgagttaaccccccttcctcactcagatgaagatgatcct
aatctggttaattttaaccgcgtcatcccccataagacacaatttttaaaattagcttat
tctagatttgaagtgactcctgaatatgaacaattttgtcaggaacaatcagaatggctt
gaggattatgccctatttatggcactcttagaagagaatgagggcaaaaattggaatcaa
tgggaaagagcgatcgcactccgagaacctgaagcgataaaaactacaacagaaacctta
aaagatgcgattaattatcacaaatttttacaatttaaattctttcaacaatggaaagct
ttaaggacttacgccaataataaaaatattaaaattattggggatatttctatttatgtc
tgttacaatagcgcggatgtttgggcaaatcctcaatgttttaaattagatcctcaaact
cttgagaagacttatattgccggtgttcctcccgattattttagtgctacaggacaactt
tgggggaatccggtttataactgggattatctgcaaaaaaccaattatgaatggtggttt
aaacggtttaaagcgacgttacaatatgcggattttgttcgggtggatcattttcgcggt
tttgaggcgtattggcaagttccggcaggagaagaaaccgctattaatggagaatggatt
aaagcaccgggtgaggacttttttgaaaagttgaaacaccatttaggaagtttaccagtt
ttagcggaagatttgggcattattaccccagaagtagaagagttacgagatcgttttgat
tttcccggaatgcggattttattatttgcgtttgatggggatactaataatccttattta
cctcaccattatgttaaaaattgtgcggtttatatcggtactcatgataatgatacggcc
atcggttggtgggaaaaagccagtcatgaggaaaagcaacgagttgcagattatttgggt
tattcttcacctgaagaaattaaagagattaattgggtgttgttgcgtttagggtttgct
tcggtggcgaatttagcgatcgttcagttacaggatattttaggattagataaccgggcg
agaatgaatgatccgagtaaaaatgaggataattggcgctggcgttatacttcttctgac
ttattaacccaagaattaagcgatcgtgtgcagaaaattacccaactttatagccgttaa

DBGET integrated database retrieval system