KEGG   Cyanothece sp. PCC 7424: PCC7424_3275Help
Entry
PCC7424_3275      CDS       T00808                                 

Definition
hopanoid-associated sugar epimerase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
cyc  Cyanothece sp. PCC 7424
Brite
Enzymes [BR:cyc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     PCC7424_3275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3670601..3671587)
Genome map
AA seq 328 aa AA seqDB search
MTIKAFVTGATGFIGANLVRLLLEQGYGVKALIRPNSRLDNLQGLNIELVQGNFNDPDLF
KLMQGCTVLFHVAAHYSLWQKDKEKLYQSNVLGTRQVLRAAHQAGIQRTVYTSSVAAIGV
GKPGDIVDETHQSPVEKLIGYYKKSKYYAEQEAIKACQMGQDIVIVNPSTPIGPLDIKPT
PTGEIILRFLRRQMPAYVDTGLNLIDVRDVAWGHLLAYQKGKTGERYILGHQNLSLKELL
EKLAQITDLKAPKTTVPHWLPLTVAWVEEQILAPLGKPPSVPLDGVRMSVQPMYYDPSKA
VRELGLPQSSIDIALKDAVEWFTTHEYI
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgacaattaaagcatttgttacaggggcaacaggatttattggtgctaacttagtacga
ctcttattagagcaaggatatggggtaaaagccttaattcgtccgaatagtcgcttagat
aatttacaagggttaaatatagaactggttcaaggaaattttaacgatccagatttattt
aaattgatgcaaggatgtacagttctatttcatgttgcggctcattattccctctggcaa
aaagacaaagaaaaactctatcaaagtaatgttttaggaactcgtcaagttttaagggca
gcgcatcaagccggaattcaaagaacagtttataccagttctgtggcagcaattggagtc
gggaaacccggagatatagtagatgaaactcatcaaagtcccgtagaaaaattaattgga
tattataaaaaatctaaatattatgcagaacaagaagctattaaagcctgtcaaatgggg
caagatattgtaattgtaaatcctagcactcccatcggcccattagatattaaaccgact
cccacaggagagattattttacgatttttgcgtcgtcaaatgccggcttatgtggatacc
ggattaaatttaattgatgtgcgagatgtagcctgggggcatttattagcctatcaaaaa
gggaaaaccggagagcgttatattttaggacatcaaaatcttagtttaaaagaattgtta
gaaaaactcgcacaaatcaccgatttaaaagcccctaaaaccacagttccccattggcta
ccccttacggttgcttgggtggaagaacaaattttagccccattaggaaaacccccgtca
gttcctttggatggggtgagaatgtccgttcaaccgatgtattatgacccttcaaaagcc
gttagagaattaggtttacctcaatcttcgatagatatcgcccttaaagacgcagttgaa
tggtttactacccatgaatatatttaa

DBGET integrated database retrieval system