KEGG   Cyanothece sp. PCC 7424: PCC7424_3674Help
Entry
PCC7424_3674      CDS       T00808                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cyc00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    PCC7424_3674
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PCC7424_3674
   00620 Pyruvate metabolism
    PCC7424_3674
   00650 Butanoate metabolism
    PCC7424_3674
  Lipid metabolism
   00071 Fatty acid degradation
    PCC7424_3674
  Amino acid metabolism
   00350 Tyrosine metabolism
    PCC7424_3674
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PCC7424_3674
   00626 Naphthalene degradation
    PCC7424_3674
Enzymes [BR:cyc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PCC7424_3674
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     PCC7424_3674
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4105975..4108638
Genome map
AA seq 887 aa AA seqDB search
MKVTNLEELEALIQRTKAAQEIYATYTQEQVDEIFKKAALAANAARIPLAKMAVAETGMG
VIEDKVIKNHFASEIIYNKYKSDKTCGVIEEDKSFGFQKIAEPVGLVAGIVPTTNPTATA
IFKSLITLKTRNGIIFSPHPRAKTCTIEAARIVLEAAIEAGAPEHLIGWIDEPSVELSQR
LMQHPNISLILATGGPGMVKAAYSSGRPSLGVGAGNTPALIDDTAHIKMAVSSIILSKTF
DNGMICASEQSVVVLDRIYDIVKEEFRERGAYFLTPEEEEKLGKVLIVDGHINGEVVGQS
VQKLAELGGFAVPENTRVLIAEVEEIGYDEPFAYEKLSPVLGMYRATDFTDGLNKAEQLV
EFAGRGHTAVLYTSPSNKDHIRQFEETIETARVLINTPSSQGAIGDIYNFRLDPSLTLGC
GTWGGNSISENVEPRHLLNIKTVAERRENMLWFRVPPKVYFKYGALPIAIRELAGKQRAF
IVTDKPLYNLGLTKGLEEVLEEIGMRYNVFYDVEPDPSLETVNRGLGVMREFNPDVIIAI
GGGSPMDAAKIMWLLYEHPEIEFEGLAMRFMDIRKRVYDLPPLGQKAILVAVPTTSGTGS
EVTPFAVVTDRRKNIKYPLADYALTPTMAVVDPELVLQMPKSLTAYGGLDALTHATEAFV
SVLASEFTTGLCLEAIRLIFKYLPSAYHNGAKDYKAREKVHYAATMAGMAFANSFLGICH
SMAHQLGAVFHVPHGLANAMMISHVIRYNATDAPFKQATFSQYKYPNAIWRYARIADYLG
LGGATKEDKVDRLIEVIEDLKRRLDVPMALKDVIHVTEAEFLAKVDEIADQAFDDQCTGS
NPRYPLIKDLRELLIKAYYGESPVTSNGNGRQYLTLEDVKTDPQPIA
NT seq 2664 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcactaaccttgaagaacttgaagcgctaattcaaagaacaaaagccgcccaa
gaaatttatgctacctacactcaagaacaggttgacgaaattttcaaaaaagctgccctc
gctgctaatgcggctcgtattcccctcgctaaaatggccgtcgctgagaccggcatggga
gttattgaggataaagtgataaaaaaccattttgcctcggaaattatctataacaaatat
aaaagtgataaaacctgtggagtcatcgaagaagataaatcttttggctttcaaaaaata
gctgaaccggtcggattagtagccggtattgttcccactactaaccccaccgccaccgcc
atttttaaatctctcattaccctaaaaacccgcaatggaattattttttctccccatccc
agagcgaaaacctgtaccatagaagccgcgagaattgtcctagaagcggcaatagaagcg
ggcgctccggaacatctcatcggttggattgatgaaccgtcggtagaattatctcaacgg
ttgatgcagcatcccaatattagcctcatcctagccacaggagggccgggaatggtcaag
gcggcttattcttctggtcgtccctctttaggggtgggagccggcaatactccggctcta
attgatgatacggcacatattaaaatggctgtatcttcgattattctcagtaaaaccttc
gataatgggatgatttgcgccagtgaacaatccgttgtggtgctggatcggatttatgat
atcgtcaaagaagaattccgggaacggggcgcttatttcctgacccccgaagaagaggaa
aaactcggtaaggttttaatcgttgatggtcatattaatggggaagtcgttgggcagtcg
gtgcaaaaattagccgagttgggcggttttgccgttcctgaaaatacccgggtactgatt
gcagaagtagaagagattggctatgatgaaccctttgcctatgaaaaattatcccctgta
ttgggaatgtatcgggcaacagattttactgatggcctcaataaagccgaacaattagtc
gaatttgccggcagaggacacaccgccgtgttatatacgtccccctccaacaaagaccac
attagacagtttgaagaaacaattgaaaccgcgcgagttttaattaatactccctcgtct
caaggggcaattggggatatctataattttcgcttagacccttctttaactttaggatgt
gggacttggggcggtaactctatcagtgaaaacgttgaaccccgtcacctcctcaatatt
aaaacggtggcagaacgccgggaaaatatgctctggtttcgtgttccccccaaagtttat
tttaaatatggagcgttaccgatcgctattcgggaattagccggcaaacaacgggcattt
attgtcaccgacaaacctctttataatttgggactgaccaaagggttagaggaggtactc
gaagaaattggcatgaggtacaatgttttttacgatgtagaacccgatccctccttagaa
acggtcaatcgagggttaggggtgatgcgagagtttaacccagatgtgatcattgccatt
ggaggaggttcgccaatggatgcggcgaaaattatgtggctattgtatgaacatccagag
atcgaatttgaagggttagcgatgcggtttatggatatccgtaaacgggtgtatgatttg
cctcccctcggacaaaaagccattttagtcgctgttcccaccacttccggcaccggctcg
gaagtgaccccctttgccgtcgtgaccgatcgacgcaaaaatattaaatatcctttggcg
gattatgccctaactccgacaatggcagtagttgatccagagttagtgttacagatgcct
aagtctttaaccgcctatgggggactagatgcccttacccatgctacagaagcctttgtc
tcggttttagcctcagaatttaccaccggactctgtttagaagcaattcggctgattttt
aaatatcttccttcggcttatcataacggggcgaaagattataaagcgagggaaaaggtg
cattatgccgcgacgatggccggtatggcctttgcgaatagctttttaggaatttgtcac
tcgatggcgcatcaattgggagcagtttttcatgttcctcacgggttagcgaatgcgatg
atgatttctcatgtcatccgttacaatgccactgatgccccctttaaacaagccactttc
tctcaatataaatatcctaatgcgatttggcgttatgctcgtatcgcggattatttgggc
ttaggtggcgcaacgaaagaggacaaagtcgatcgcttgatagaagtgatagaagacctt
aaacgtcgcttagatgtgccgatggcgttaaaagacgttattcatgtcactgaagcggaa
tttttagcgaaagtcgatgaaatcgccgatcaagcgtttgacgatcagtgtacgggttca
aatcctcgttatcctttaattaaagaccttagagagcttttaattaaggcttattatgga
gaatctccggtgactagcaacggcaacggcagacaatatttaaccctagaagatgtcaaa
accgatcctcaaccgatcgcctaa

DBGET integrated database retrieval system