KEGG   Cyanothece sp. PCC 7424: PCC7424_3782Help
Entry
PCC7424_3782      CDS       T00808                                 

Definition
phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
Pentose phosphate pathway
Carbon fixation in photosynthetic organisms
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyc00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PCC7424_3782
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    PCC7424_3782
Enzymes [BR:cyc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     PCC7424_3782
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4207741..4210149)
Genome map
AA seq 802 aa AA seqDB search
MVAAPEKPTIQQDPLSAEELRKIDAYWRACNYLAVGMIYLKDNPLLKRPLQPEDIKPRLL
GHWGTSPGLSFTYVHLNRLINKYDLDMIYMAGPGHGAPGVLGPVYLEGTYSEIYPDKSED
EEGMQKFFKQFSFPGHIGSHCTPETPGSIHEGGELGYSVSHAYGAAYDNPDLIVSVVVGD
GEAETGALATSWHSNKYLNPIRDGAVLPILHLNGYKIANPTILARITPEELESLFIGYGY
TPYVVEGDDPHLMHQKMAATLEHCINQIRHIQQEARSSGVVHRPRWPMIILRSPKGWTGP
KEVDGHKVEGFWRAHQVPMGNMQNNPEHLRMLEEWMKGYRPDELFDENGKLIPELKELAP
KGHRRMSANLHANGGVLRKDLRMPDFRDYAVEISTPGTEEVENTRLLGEFLRDVMRNNMT
SFRLFGPDETASNRLQAVYEVSQKTWMAEFYPEDLDGSYLSREGRVMEMLSEHTLEGWLE
GYLLTGRHGFFHTYEAFAHVIDSMFNQHAKWLDICKHDVHWRASVSSLNILLSSVVWRQD
HNGFSHQDPGFIDLVTNKSAEVVRVYLPPDANCLLSVANHCLRSKDYVNVIVADKQKHLQ
YLSMDEAIKHCTKGIGIWEWASNDDQGKEPDEPDVIMACCGDIPTMESLAATAILREEFP
ELKVRFINVVDLFKLQSESEHPHGLSEWDFDSLFTHDKPIIFNFHGYPWLIHKLTYRRSN
QERIHVRGYKEEGNINTPLELAIRNQVDRFNLVIDVIDRVPKLGSAAAYVKERMKNEIID
NLQHAFEQGSDKPEIVEWKWPY
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atggtcgcagcaccagaaaaaccaaccatacaacaagaccccttatctgctgaagaactc
cgaaaaatagatgcttactggcgagcttgcaactatttggctgttgggatgatttatctc
aaagataatcctttactcaaaagacccctacaacccgaagacattaaaccccgcttgctc
ggacattggggaacatcgcccggattaagtttcacttatgttcacctcaatcgactgatc
aacaaatatgatttagacatgatttacatggccgggccgggtcatggtgcgcctggggta
ctcggccctgtttacttagagggaacatactcagaaatttatcccgataagagcgaagat
gaagaaggaatgcaaaaattctttaaacagttttcctttcccggtcatatcggaagtcac
tgtacccctgaaactcccggctctatccatgaagggggagaattaggatacagcgtttcc
catgcttacggtgcagcttatgataatccagatttaattgtatcagtagttgtgggagac
ggagaagcagaaaccggagccttagccacctcctggcactccaacaaataccttaacccg
attcgagacggggcagtcttacccattttgcaccttaacggctataaaattgctaatcca
acgatcctcgctcgtattacccctgaagaactcgaaagcttatttattgggtatggatac
accccttatgtggtcgaaggggatgatccccacctgatgcaccaaaaaatggccgccacc
ctagaacactgtatcaaccaaattcgccatatacaacaagaagcccgcagcagtggagtc
gtacaccgtcctcgctggccgatgattattcttcgcagtcctaaagggtggacagggcca
aaagaagtcgatgggcacaaagtcgaagggttttggcgggcgcatcaagtgccaatggga
aatatgcaaaataatcccgaacacctgagaatgttagaagagtggatgaaaggttataga
ccggatgaactcttcgacgagaacggtaaactcattcccgaactgaaagaacttgctccc
aaaggacatcggcggatgagtgctaacctccatgccaacggtggggtattacgaaaagat
ttaagaatgcccgattttcgggattatgcggtggagatttctacccctggcacagaagaa
gtcgaaaatactcgcttattgggtgagtttttacgggatgtgatgagaaataacatgacc
tccttccgtctctttggccctgatgaaaccgcctccaaccgtcttcaagcggtatatgaa
gtgagtcaaaaaacctggatggctgagttttaccctgaagatttagacggaagctactta
tcccgtgagggtcgagtgatggaaatgctcagtgagcataccctagaaggatggttagaa
ggatatctcttaaccggaagacatggatttttccatacttatgaagcttttgcccacgtt
attgattcgatgtttaaccaacacgccaaatggttagatatttgtaaacatgacgttcat
tggcgagcttcagtttcttccttaaatattctcctgtcttctgtcgtttggcgacaagat
cataacgggtttagtcaccaagatcccggttttatcgatttagtaactaataagagtgcg
gaagtggtgcgggtttatctccctcccgatgccaattgtttgctctcagtagcgaatcac
tgcttacggagtaaagactatgttaacgtcatcgtggctgacaaacagaagcacctgcaa
tatctcagcatggacgaagccattaaacactgtactaaaggaattggcatttgggagtgg
gcgagtaatgatgaccaagggaaagaaccggacgaacccgacgttatcatggcttgttgt
ggtgatattcctacaatggaatctttagcggctactgctattttacgggaagaatttcct
gagcttaaagtgcgttttattaacgtagttgacctatttaagttacaatctgaaagcgaa
caccctcacggattatctgaatgggattttgatagtctctttactcacgataaaccgatc
atctttaactttcatggttatccctggttaattcataaactaacctatcggcgtagtaac
caagaacggattcatgtaagaggttacaaagaagaagggaatattaacacccctctagaa
ttagccattagaaaccaagtcgaccggtttaacctcgtaattgatgtgatcgatcgagtt
cctaaattaggatcagccgccgcctatgttaaagagcggatgaagaacgaaattatcgac
aaccttcaacacgcttttgaacagggtagcgataaacccgaaatcgttgaatggaagtgg
ccttattag

DBGET integrated database retrieval system