KEGG   Cyanothece sp. PCC 7424: PCC7424_3797Help
Entry
PCC7424_3797      CDS       T00808                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cyc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PCC7424_3797
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PCC7424_3797
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PCC7424_3797
Enzymes [BR:cyc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PCC7424_3797
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4224115..4225362
Genome map
AA seq 415 aa AA seqDB search
MTTTMTTTPIRDTQSKQYPDELGRFGPYGGKYVPETLMPALSELESAYNRYKNDPDFQQE
LNQLLKDYVGRPSPLYFAERLTARYARPDGTGPQIYLKREDLNHTGAHKINNALAQVLLA
KRMGKGRIIAETGAGQHGVATATVCARFGLECIIYMGVHDMERQKLNVFRMRLLGATVQP
VSAGTGTLKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMIVRDFHAVIGKETRAQCEE
KWGGLPDILMACVGGGSNAMGLFYEFIKDPSVRIIGVEAAGESVASGKHAATLTAGRPGV
LHGAMSYLLQDEDGQVIEPHSISAGLDYPGVGPEHSYLKDSRRAEYYSVTDAEAVAAFQR
LSQLEGIIPALETSHAIAYLETLCPQLEGSPRIIINCSGRGDKDVQTVAKFIEQE
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgaccactacaatgacaaccacaccgatccgtgacacacaatcaaaacaatatcccgat
gaattaggacgttttggcccctatggagggaaatatgtcccagaaaccttgatgccggct
ttaagtgaactagagtccgcctacaaccgctacaaaaatgacccagactttcagcaagaa
ttaaatcaacttctcaaagactatgtcggaagacctagccctctatactttgccgaacgc
ctcaccgcccgttatgctagaccggacgggactggcccacaaatttatctcaaacgagaa
gatctcaatcatacaggggcccataaaattaataatgccttagctcaggtacttttggcc
aaacgcatgggaaaagggcgtattattgctgaaaccggtgccggtcaacatggagtcgcc
accgccaccgtctgcgcccgttttggtctggaatgtattatttatatgggcgttcatgat
atggaacgtcaaaaattaaacgtctttcgcatgagattattaggggcgacagttcaaccc
gtatccgccggcaccggaaccctcaaagatgccacctcagaagcgatccgagactgggtg
actaatgtagaaaccacccattatattctcggttcagtggccggcccccatccttatccg
atgatcgtccgagattttcatgcagtgatcggcaaagaaactcgcgcccaatgtgaagaa
aaatggggcggactcccagatatcctgatggcctgtgtgggagggggatcaaatgcaatg
ggactattttatgagtttatcaaagacccaagtgtcagaattatcggagtagaagccgcc
ggagaaagtgtggcctctggaaaacacgccgccaccttaaccgcaggccggccaggggta
ttacatggggcgatgagttatctccttcaagatgaggatggacaagtgatagaacctcat
tctatcagtgctggcttggactatccaggggtagggccagaacatagttatcttaaagat
agtcgtcgggcagaatattacagtgtgacggatgctgaagcggtggccgcttttcaacgg
ttgtcccagttagaagggattattccggcgttagaaacctcccacgcgatcgcctattta
gaaaccctttgccctcaattagaaggaagtccccgcattattattaactgttcaggccga
ggggataaagatgtgcaaacggtggctaaatttatcgaacaggaatga

DBGET integrated database retrieval system