KEGG   Cyanothece sp. PCC 7424: PCC7424_3801Help
Entry
PCC7424_3801      CDS       T00808                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
cyc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cyc01100  Metabolic pathways
cyc01110  Biosynthesis of secondary metabolites
cyc01130  Biosynthesis of antibiotics
cyc01230  Biosynthesis of amino acids
Module
cyc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cyc00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PCC7424_3801
Enzymes [BR:cyc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     PCC7424_3801
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS ThiG His_biosynth NanE FMN_dh Nuc_rec_co-act IMPDH
Motif
Other DBs
NCBI-ProteinID: ACK72182
JGI: PCC74243801
UniProt: B7KJ98
Position
4227806..4228693
Genome map
AA seq 295 aa AA seqDB search
MEIRRRSPNPAVNVDTLRYQVQVPDSQPRHILEEIIWNKEIEVDKIRERIPLLELRKKVK
DMPPPRNFLEALRNGKTKPALIAEVKKASPSKGVIQENFDPVAIAKSYQQGGASCLSVLT
DAKYFEGSYENLALVRQTVDLPLLCKEFIIYPYQIYYARTQGADAVLLIAAILTDRDLEY
FVKILNQLGMTALIEVHTLAELDRVLGIEGVKLVGINNRNLETFKVDLNTTSELLEARRE
QLQDKEILIVSESGIHTPEDLQLVKQAGADAVLIGESLVKQQDPAQTITELFSRV
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggaaattagaagacgatcgcccaatccggcagtaaacgttgataccttacgttaccaa
gtgcaagttcctgatagtcaacctcggcacatattagaagaaattatttggaataaagag
atagaagtcgataaaattcgagaacgcatacctttactagaattacgcaaaaaagttaaa
gatatgcctcctcctcgtaactttctcgaagccttacgcaatggaaagacaaaaccagct
ttaattgcagaagtgaaaaaagcctctcccagtaaaggggtgatacaagaaaactttgat
cccgtagcgatcgccaaaagttatcaacaagggggagcaagttgtctatcagttttaacc
gatgccaaatactttgagggaagttatgaaaatctcgctttagtgcgtcaaaccgtagac
ttacccctattatgtaaagagtttatcatctatccttatcaaatttattatgctcgcact
caaggagcagatgcagtattactgattgcagctattttaaccgatcgagatttagaatat
tttgtcaaaattctcaatcaattgggaatgacagcattaatcgaagttcatactttagca
gaactcgatcgggtattagggattgagggagtaaaattagtaggaatcaacaaccgcaat
ttagaaacctttaaggtagatctaaacaccacatctgaacttttagaagccagacgggaa
caactccaagacaaagagattcttattgtgagtgaatctgggatacatactccagaagat
ttgcaattagttaagcaagccggggctgatgctgtattaattggagaatctttagttaaa
cagcaagatccggctcaaacaattaccgagttgttttctagagtataa

DBGET integrated database retrieval system