KEGG   Cyanothece sp. PCC 7424: PCC7424_3847Help
Entry
PCC7424_3847      CDS       T00808                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cyc00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4278941..4279597
Genome map
AA seq 218 aa AA seqDB search
MTLSKSERSIINSSQHSLPPLTTEHHSPVSEADMIQAVRTLLLGLGEDPDREGLRDTPKR
VVKALKFLTSGYHQSLDELLNGAVFGEDTNEMVLVRDIDLFSSCEHHILPILGRAHVAYI
PNGKVIGLSKIARICEMYARRLQVQERLTAQIADALQGLLKPQGVAVVIEATHMCMVMRG
VQKPGSWTSTSAVRGVFAEDAKTRQEFMSLIRHNPAFH
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaccttatctaagtccgaacgtagtatcatcaattcttctcagcattctcttcctcct
ttaacgacagaacatcattctcctgtctctgaagcggatatgattcaagcggtacggact
ttacttctaggattaggagaagatccggatcgggaaggtttaagagatacgccaaaaaga
gtcgttaaagctttaaaatttctcacatcaggctatcatcaatccctagatgaattgctt
aatggagcagtttttggagaagatactaatgaaatggtattggttagagatattgattta
tttagttcctgtgaacatcatattttgcctattttaggacgcgctcatgttgcttatatt
cctaatggaaaagtaattggactctcaaaaattgcacggatttgtgaaatgtatgctaga
cgtttacaggttcaagaacgattgacggcacaaattgctgatgcacttcaaggattactt
aaacctcaaggggttgctgttgttattgaagcaactcatatgtgtatggtaatgcgtggc
gtacaaaaaccaggatcttggacttctacgagtgcggtgcggggtgtctttgcggaagat
gctaaaacccgtcaagaattcatgagtttgattcgtcataatccggcatttcattaa

DBGET integrated database retrieval system