KEGG   Cyanothece sp. PCC 7424: PCC7424_4008Help
Entry
PCC7424_4008      CDS       T00808                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
cyc00010  Glycolysis / Gluconeogenesis
cyc00051  Fructose and mannose metabolism
cyc00562  Inositol phosphate metabolism
cyc00710  Carbon fixation in photosynthetic organisms
cyc01100  Metabolic pathways
cyc01110  Biosynthesis of secondary metabolites
cyc01120  Microbial metabolism in diverse environments
cyc01130  Biosynthesis of antibiotics
cyc01200  Carbon metabolism
cyc01230  Biosynthesis of amino acids
Module
cyc_M00002  Glycolysis, core module involving three-carbon compounds
cyc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cyc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PCC7424_4008
   00051 Fructose and mannose metabolism
    PCC7424_4008
   00562 Inositol phosphate metabolism
    PCC7424_4008
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    PCC7424_4008
Enzymes [BR:cyc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PCC7424_4008
Exosome [BR:cyc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PCC7424_4008
  Exosomal proteins of bladder cancer cells
   PCC7424_4008
  Exosomal proteins of melanoma cells
   PCC7424_4008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM Hs1pro-1_N
Motif
Other DBs
NCBI-ProteinID: ACK72382
JGI: PCC74244008
UniProt: B7KL10
Position
complement(4441743..4442468)
Genome map
AA seq 241 aa AA seqDB search
MRKIIIAGNWKMYKTQAEALEFVQVFKSKIEDTDESREIVLCAPFTDLGAMSKNLHGSRI
KLGAQNVHWEEAGAYTGEISGAMLTEIGVSYVIVGHSERRQYFGDTDETVNLRVLAAQKY
GLIPILCVGESKSQRDAGETEKIIINQLKRDLVDVDQNKLVIAYEPIWAIGTGDTCESSE
ANRVIGIIREQLTNKNVSIQYGGSVKPGNIDEIMKQSEIDGALVGGASLNPADFAQIVNY
K
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
gtgcggaaaattatcattgctggtaactggaaaatgtacaagactcaagcagaagctctg
gagtttgtgcaagtatttaaatcaaaaatagaggatacagacgaatctagagaaatagtc
ttatgcgccccctttactgatttaggagcaatgtctaaaaatttacatgggagtcgcatt
aaattaggggcgcaaaatgtccactgggaagaagccggtgcctacacaggtgaaatttcc
ggggcaatgctaaccgaaatcggggtgagttatgtcattgtgggtcatagtgaacgccgt
caatatttcggagacaccgatgaaaccgtcaatttaagagtccttgcggctcaaaaatac
gggttaattcctatcctctgtgttggggaatctaaatctcaacgggatgcaggagaaacg
gaaaagatcatcattaatcaattaaaacgggatttggttgatgtagatcaaaataagtta
gtcattgcttatgaacccatctgggccattgggactggtgacacctgtgaatcttcagaa
gctaaccgagttatcggcatcattcgagaacaattaaccaataaaaatgtctcgattcaa
tatggaggttctgttaaacccggtaatattgatgaaattatgaaacaatcagaaattgat
ggtgctttagtcggcggtgctagtttaaatccggcagatttcgcccagattgttaattat
aaatag

DBGET integrated database retrieval system