KEGG   Cyanothece sp. PCC 7424: PCC7424_4008Help
Entry
PCC7424_4008      CDS       T00808                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cyc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PCC7424_4008 (tpiA)
   01230 Biosynthesis of amino acids
    PCC7424_4008 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PCC7424_4008 (tpiA)
   00051 Fructose and mannose metabolism
    PCC7424_4008 (tpiA)
   00562 Inositol phosphate metabolism
    PCC7424_4008 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    PCC7424_4008 (tpiA)
Enzymes [BR:cyc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PCC7424_4008 (tpiA)
Exosome [BR:cyc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PCC7424_4008 (tpiA)
  Exosomal proteins of bladder cancer cells
   PCC7424_4008 (tpiA)
  Exosomal proteins of melanoma cells
   PCC7424_4008 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4441743..4442468)
Genome map
AA seq 241 aa AA seqDB search
MRKIIIAGNWKMYKTQAEALEFVQVFKSKIEDTDESREIVLCAPFTDLGAMSKNLHGSRI
KLGAQNVHWEEAGAYTGEISGAMLTEIGVSYVIVGHSERRQYFGDTDETVNLRVLAAQKY
GLIPILCVGESKSQRDAGETEKIIINQLKRDLVDVDQNKLVIAYEPIWAIGTGDTCESSE
ANRVIGIIREQLTNKNVSIQYGGSVKPGNIDEIMKQSEIDGALVGGASLNPADFAQIVNY
K
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
gtgcggaaaattatcattgctggtaactggaaaatgtacaagactcaagcagaagctctg
gagtttgtgcaagtatttaaatcaaaaatagaggatacagacgaatctagagaaatagtc
ttatgcgccccctttactgatttaggagcaatgtctaaaaatttacatgggagtcgcatt
aaattaggggcgcaaaatgtccactgggaagaagccggtgcctacacaggtgaaatttcc
ggggcaatgctaaccgaaatcggggtgagttatgtcattgtgggtcatagtgaacgccgt
caatatttcggagacaccgatgaaaccgtcaatttaagagtccttgcggctcaaaaatac
gggttaattcctatcctctgtgttggggaatctaaatctcaacgggatgcaggagaaacg
gaaaagatcatcattaatcaattaaaacgggatttggttgatgtagatcaaaataagtta
gtcattgcttatgaacccatctgggccattgggactggtgacacctgtgaatcttcagaa
gctaaccgagttatcggcatcattcgagaacaattaaccaataaaaatgtctcgattcaa
tatggaggttctgttaaacccggtaatattgatgaaattatgaaacaatcagaaattgat
ggtgctttagtcggcggtgctagtttaaatccggcagatttcgcccagattgttaattat
aaatag

DBGET integrated database retrieval system