KEGG   Cyanothece sp. PCC 7424: PCC7424_4044Help
Entry
PCC7424_4044      CDS       T00808                                 

Definition
magnesium chelatase ATPase D (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cyc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PCC7424_4044
Enzymes [BR:cyc01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     PCC7424_4044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4480770..4482785
Genome map
AA seq 671 aa AA seqDB search
MPSLTSSRAKMNFPLSAVVGQDAIKLALLLTSVDPGLGGVAIAGRRGTAKSVMARAIHAL
LPPIEVIKDNPFNCDPTNREEWDDQTLQQYSNTIDIPTEIIPAPFIQIPIGVTEDRLLGS
VDVEESVKRGEAVFQPGLLASAHRGVLYIDEINLLDDQIANQLLSVLSEGRNIIEREGLS
FQHPCKPLLIATYNPEEGPLREHLLDRIAIALSADGVLALDQRLQAVDRAIEYANSPQVF
IEQYNEEIDDLKTEIILAREWLKDVKISHDQIAYLVEEAIRGQVQGHRAEIFAVRVAKAS
AALDGRNTVTPDDLRRAVELVIVPRSIIIDRPPEQDQTPPPPPPPPEQPQDESEPDQDEP
EDENKEEPEQEPDSIPDEFVFDVEGVLLDPSVLYFAQMAQRQGKSGSRSLIFSEDRGRYI
KPMLPKGKVKRIAVDATLRAAAPYQRARRLRHPERKVIVEQGDIRSKRLARKAGALIIFV
VDASGSMALNRMQSAKGAVMRLLTEAYENRDQVALIPFRGEKADVLLPPTRSIALAKKRL
ETLPCGGGSPLSHGLTQAVHVGMNAMMSGDIGQVVIVAITDGRGNIPLVKSLGEPLPEGE
KPDIKAELLEIAGKIRGVGMKLLVIDTEKKFVSTGFAKELATQAGGKYYHLPRATDQAIA
SMAKGAIADIR
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgccttccctcacctctagccgagctaaaatgaatttccctctgagtgctgtagtagga
caagacgcgatcaaactcgctcttttgttaacgtcagttgatcctggactcggaggagta
gcgatcgccggacggagaggaacggccaaatcagtgatggcgcgggcaattcacgcctta
ttacctcccatagaagtgatcaaagataacccgtttaactgtgaccccacgaatcgggag
gagtgggatgatcagaccttacagcagtatagtaatactatagatattcccacagaaatt
atccccgctcccttcattcaaattcccatcggggtaacagaagaccgtttattaggatca
gtcgatgtagaagagtcggttaagcgaggagaagcggtttttcaacccggtttattagcc
tcggctcatcgaggagtattatatatagatgaaattaatcttctcgatgaccaaatagcc
aatcaactcttaagcgttttaagtgaaggccgcaacatcattgaacgggaaggattaagt
tttcaacatccctgtaaaccgttgctcatcgctacctataatcctgaagaagggccatta
agagaacatttattagatcgaattgcgatcgccttgtccgcagatggagtattagcctta
gatcagcgtttacaagcggtcgatcgagccatagaatacgccaactcacctcaagtgttt
attgagcagtataacgaagaaatagacgacctgaaaaccgaaattattttagcgcgagaa
tggctcaaagatgtaaaaattagccacgatcagattgcctatttagtcgaagaagccatc
agaggacaagttcaaggacaccgggcagaaatttttgcggtgcgagtagccaaagcctca
gccgccttagatgggcgaaataccgtcactccagacgatttaagacgggcagtagaatta
gtgatcgtgcctcggtctattattattgatagaccccccgaacaagatcaaaccccaccc
ccaccgccacccccacccgaacaacctcaagatgagtccgaaccggatcaagacgaaccc
gaagacgaaaacaaagaagaacccgaacaagaacccgatagtattcccgatgaatttgtc
tttgatgtcgagggagttttgttagatcccagtgttctctattttgctcaaatggcgcaa
cgacaagggaagtcaggaagccggagtctaatcttttctgaggatagagggcgctatatt
aaacccatgttaccgaaggggaaagtcaaacggatcgccgttgatgccacattacgggcg
gctgccccctatcaaagagccagacggttgcgtcatccggaacggaaagttatcgtcgaa
caaggggatatccggtctaaacgcttggccagaaaagccggggcgttaataatatttgta
gtcgatgcgtcaggttcaatggccttaaaccggatgcagtcggcaaaaggggcagtgatg
cggttattaaccgaagcctatgaaaaccgagatcaggttgccttaataccctttcgggga
gaaaaagcagatgttttattaccgccaacgagatcgatcgccttagctaaaaaacgctta
gaaaccttaccctgtggtggcggttctcccttatctcatgggttaactcaggcggttcat
gtgggcatgaatgcgatgatgtccggcgatattggtcaagtggtcattgtagccattact
gatggacgggggaatattcctctggttaagtctttaggtgaaccgttacccgaaggagaa
aagcccgatattaaggcagaattgttagaaattgcgggtaaaattcggggagttggcatg
aaattgttagttattgataccgagaaaaaatttgtttccactggctttgctaaggagtta
gcgactcaagctggagggaaatattatcacttaccgagggcgacggatcaggctattgct
tcgatggcgaaaggggcgatcgcggatattagatga

DBGET integrated database retrieval system