KEGG   Cyanothece sp. PCC 7424: PCC7424_4054Help
Entry
PCC7424_4054      CDS       T00808                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:cyc01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:cyc00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4491192..4492670)
Genome map
AA seq 492 aa AA seqDB search
MTPFTFENLVSHAPEGRFNGIERHYTPEDVQKLRGSIKIEYTLAQLGANRLWELLHKEDY
INALGAVTGNQAMQMVKGGLKAIYLSGWQVAADANLAGTMYPDQSLYPANSGPELCRRIN
RTFQRADQIHHSEGRNGVNWFAPIVADAEAGFGGPLNSFEIMKAYIEAGAAAVHYEDQLA
SEKKCGHLGGKVLIPTAAHIRNLNAARLAADVMGVSTLIVARTDAESAKLITSDIDERDR
PFITGERTPEGFYRLREGSGLDHCIARGLSYAPYADLLWWETSKPNLEEARIFAEAIHKQ
YPGKLLAYNCSPSFNWRANLDDETIAKFQKELGAMGYKFQFVTLAGFHSLNHSMFELARH
YAHSGMEAYSQLQEAEFASEEQGYTATRHQREVGTGYFDAVSVAISGGQSSTTAMASSTE
AAQFQSHENHHNGDSEPENVPPVWYEIVNARIGSGTLRHPEEVKAFEAFKEARYARIKEA
YREIEEIAHLDD
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgaccccattcacctttgaaaatttagtttcccatgctcccgaaggccgttttaacgga
attgagcggcattataccccggaagacgttcaaaaactccgaggctcaattaaaattgaa
tataccttagcccaacttggcgctaatcggttatgggaacttttacataaagaagattat
attaatgcccttggggcagttaccggtaaccaagcgatgcaaatggtaaaagggggactc
aaagccatttatttatccgggtggcaagtggccgccgatgctaatcttgccggtacgatg
tatccggatcaaagtctgtatccggctaatagtggcccagaattatgtcgtcgcattaac
cgcacattccaacgggctgatcaaattcaccacagtgaaggccgaaacggggttaactgg
tttgctcccatcgtcgccgatgcagaagccggctttggggggcctcttaacagttttgaa
atcatgaaagcctatattgaagccggagcggcggcggtacactacgaagatcaactcgcc
tctgagaaaaaatgcggccatttagggggtaaagtgttaattcctacagccgcccatatc
cgcaacctcaacgccgcccgactcgccgccgatgtcatgggagtttcgaccttaattgtc
gcccggacggatgcagaaagcgctaaactgatcaccagtgatattgatgaacgtgatcgc
ccgtttattaccggcgaacggactccagaaggattttatcgcttacgggaagggtcagga
ttagatcattgtatcgccagaggattatcctatgcgccctacgctgatttactctggtgg
gaaacctccaaaccgaacctagaagaagcgcgaatctttgccgaggcaattcataaacag
tatccgggtaaactcctcgcttataactgttctccttcctttaactggagagctaaccta
gatgacgaaaccattgctaaattccagaaagaattaggcgcaatgggctataaattccag
tttgtcaccttagccggtttccacagcctcaaccacagtatgtttgaattagctcgtcat
tacgcccatagcggcatggaagcttattctcaactccaagaggcagaatttgccagcgag
gaacagggttataccgctactcgtcatcaaagagaggtaggtacgggctactttgacgcg
gtttccgttgccatttctgggggacaatcttcgactactgctatggcttcctccacagag
gcggctcaattccaaagtcatgaaaatcatcacaatggtgatagtgagccggaaaatgtt
cctcccgtttggtatgaaattgttaacgctcggattggtagtgggacactacgccatcct
gaagaagttaaagcgtttgaagccttcaaagaagcccgttatgctcggataaaagaagct
tatcgggaaatagaagaaattgctcacctcgatgactaa

DBGET integrated database retrieval system