KEGG   Cyanothece sp. PCC 7424: PCC7424_4055Help
Entry
PCC7424_4055      CDS       T00808                                 

Definition
(RefSeq) malate synthase A (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cyc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PCC7424_4055
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PCC7424_4055
   00630 Glyoxylate and dicarboxylate metabolism
    PCC7424_4055
Enzymes [BR:cyc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PCC7424_4055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4492780..4494396)
Genome map
AA seq 538 aa AA seqDB search
MVLTATNQTKITQGIRIRGKMSDEYAQILSPEALHFLAMLQRRFGARRSHLLELRQTIQQ
QINAGWLPDFPEETENIRRSDWKIASIPPDLQDRRVEITGPVDRKMIINALNSGANAYMA
DFEDSSSPTWDNMVSGQLNLRDAVAETIEYRDDKKNKVYRLNEKTAVLIVRPRGWHLLEE
HLLIDEQPISASLFDFGLYFFHNVEKLREKGTAPYFYLPKLENRHEATLWNDVFIAAQEA
LGIPTGTIKVTVLLETILASFEVDEILHALKDHIVALNCGRWDYIFSFIKKFSHRQDFVL
PERSQVTMTRHFMRSYSLLTIATCHRRGALAMGGMAAQIPIKSDPEANQLALAKVRSDKE
REVNDGHDGTWVAHPALVPLAKEVFDSKMKGLNQLSVLRNDVQVTAADLLTVPEGTITEA
GIRNNIRVGILYISAWLEGIGCVPLYNLMEDAATAEICRAQLWQWLHHHAKLEDRRNFDL
CLFQSLLDEETATLRQENQTTLAIFDKAVELFQQLVTAEEFEEFLTLKAYPQILEFDE
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggttcttactgctacaaatcaaacaaaaattactcaaggaatacgtattcgtggcaaa
atgtctgacgaatacgcccaaatcctctccccagaagccttacattttctagcgatgtta
cagcgccgttttggcgcgagacgttctcaccttttagagcttagacaaaccattcagcaa
caaatcaacgccggatggttgcccgattttcccgaagaaacggaaaatattcgtcgtagt
gactggaaaatagcctctatccccccagatttacaagaccggcgggttgaaatcaccggg
ccagttgaccgcaaaatgatcattaatgcccttaattccggggctaatgcttatatggcc
gactttgaagactcctctagtccgacttgggataatatggtgtccggtcaactgaattta
cgggatgctgtcgccgaaacgattgaatatcgagatgacaaaaagaataaagtttatcgc
cttaacgaaaaaaccgccgttttaattgttcgtcctagagggtggcatctgttagaagaa
catcttttaattgacgagcaacctatctccgcctctttatttgattttgggttatatttc
tttcataacgtggaaaaattacgggaaaaaggcactgccccctatttttacttacccaaa
ttagaaaaccgccacgaagccaccctctggaatgatgtatttatagcggctcaagaagcg
ttaggcatccctacaggaacgattaaagtaaccgtattactcgaaaccattctagcctct
tttgaagttgacgaaattctccacgctcttaaagatcatatcgtcgctctcaactgtggc
cgctgggattatattttcagctttatcaaaaagtttagccatcgtcaagactttgtgcta
ccagaacgctctcaagtgaccatgacccgacatttcatgcgttcctatagcttactcacc
atcgcaacttgtcaccgtcgtggagctttagcaatgggcggtatggccgcacaaattccc
atcaaatcagaccccgaagccaatcaactcgccttagcaaaagttcgctctgataaagaa
cgggaagtcaacgatggtcatgacgggacttgggtagctcaccctgcccttgtccctttg
gctaaagaagtatttgacagtaagatgaagggacttaatcaactgtcggtacttcgtaat
gatgtacaggtaacagcagccgacttattaaccgttccggaagggacgattacagaagcg
ggtatccgaaataacattcgggtggggatattatatatcagcgcttggttagagggtatt
ggctgcgttcccttgtataatttaatggaagatgccgcgaccgccgaaatttgtcgggca
caactttggcagtggttacaccatcacgctaaactagaggacagacgcaatttcgattta
tgcttgtttcaatcccttctcgatgaagaaacagctaccttgcgtcaagaaaatcaaacg
acattagccatctttgacaaagctgtggaattattccaacagttagtcacggctgaggag
tttgaagagtttttaaccctaaaagcttaccctcaaattcttgagtttgacgaataa

DBGET integrated database retrieval system