KEGG   Cyanothece sp. PCC 7424: PCC7424_4055Help
Entry
PCC7424_4055      CDS       T00808                                 

Definition
malate synthase A (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:cyc01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:cyc00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:cyc00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4492780..4494396)
Genome map
AA seq 538 aa AA seqDB search
MVLTATNQTKITQGIRIRGKMSDEYAQILSPEALHFLAMLQRRFGARRSHLLELRQTIQQ
QINAGWLPDFPEETENIRRSDWKIASIPPDLQDRRVEITGPVDRKMIINALNSGANAYMA
DFEDSSSPTWDNMVSGQLNLRDAVAETIEYRDDKKNKVYRLNEKTAVLIVRPRGWHLLEE
HLLIDEQPISASLFDFGLYFFHNVEKLREKGTAPYFYLPKLENRHEATLWNDVFIAAQEA
LGIPTGTIKVTVLLETILASFEVDEILHALKDHIVALNCGRWDYIFSFIKKFSHRQDFVL
PERSQVTMTRHFMRSYSLLTIATCHRRGALAMGGMAAQIPIKSDPEANQLALAKVRSDKE
REVNDGHDGTWVAHPALVPLAKEVFDSKMKGLNQLSVLRNDVQVTAADLLTVPEGTITEA
GIRNNIRVGILYISAWLEGIGCVPLYNLMEDAATAEICRAQLWQWLHHHAKLEDRRNFDL
CLFQSLLDEETATLRQENQTTLAIFDKAVELFQQLVTAEEFEEFLTLKAYPQILEFDE
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggttcttactgctacaaatcaaacaaaaattactcaaggaatacgtattcgtggcaaa
atgtctgacgaatacgcccaaatcctctccccagaagccttacattttctagcgatgtta
cagcgccgttttggcgcgagacgttctcaccttttagagcttagacaaaccattcagcaa
caaatcaacgccggatggttgcccgattttcccgaagaaacggaaaatattcgtcgtagt
gactggaaaatagcctctatccccccagatttacaagaccggcgggttgaaatcaccggg
ccagttgaccgcaaaatgatcattaatgcccttaattccggggctaatgcttatatggcc
gactttgaagactcctctagtccgacttgggataatatggtgtccggtcaactgaattta
cgggatgctgtcgccgaaacgattgaatatcgagatgacaaaaagaataaagtttatcgc
cttaacgaaaaaaccgccgttttaattgttcgtcctagagggtggcatctgttagaagaa
catcttttaattgacgagcaacctatctccgcctctttatttgattttgggttatatttc
tttcataacgtggaaaaattacgggaaaaaggcactgccccctatttttacttacccaaa
ttagaaaaccgccacgaagccaccctctggaatgatgtatttatagcggctcaagaagcg
ttaggcatccctacaggaacgattaaagtaaccgtattactcgaaaccattctagcctct
tttgaagttgacgaaattctccacgctcttaaagatcatatcgtcgctctcaactgtggc
cgctgggattatattttcagctttatcaaaaagtttagccatcgtcaagactttgtgcta
ccagaacgctctcaagtgaccatgacccgacatttcatgcgttcctatagcttactcacc
atcgcaacttgtcaccgtcgtggagctttagcaatgggcggtatggccgcacaaattccc
atcaaatcagaccccgaagccaatcaactcgccttagcaaaagttcgctctgataaagaa
cgggaagtcaacgatggtcatgacgggacttgggtagctcaccctgcccttgtccctttg
gctaaagaagtatttgacagtaagatgaagggacttaatcaactgtcggtacttcgtaat
gatgtacaggtaacagcagccgacttattaaccgttccggaagggacgattacagaagcg
ggtatccgaaataacattcgggtggggatattatatatcagcgcttggttagagggtatt
ggctgcgttcccttgtataatttaatggaagatgccgcgaccgccgaaatttgtcgggca
caactttggcagtggttacaccatcacgctaaactagaggacagacgcaatttcgattta
tgcttgtttcaatcccttctcgatgaagaaacagctaccttgcgtcaagaaaatcaaacg
acattagccatctttgacaaagctgtggaattattccaacagttagtcacggctgaggag
tttgaagagtttttaaccctaaaagcttaccctcaaattcttgagtttgacgaataa

DBGET integrated database retrieval system