KEGG   Cyanothece sp. PCC 7424: PCC7424_4108Help
Entry
PCC7424_4108      CDS       T00808                                 

Definition
magnesium chelatase subunit H (EC:6.6.1.2)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cyc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PCC7424_4108
Enzymes [BR:cyc01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     PCC7424_4108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4551090..4554800
Genome map
AA seq 1236 aa AA seqDB search
MKRIVLIAGFESFNADLYRKAAELATSRCPELDIQVFSDRALTEQPETVETALKNAQVFF
ASLIFDYDQVIWLRQRVQQIPIRLVFESALELMSLTQLGKFAIGDKPKGMPKPIQFILSK
FSSGKEEDKLAGYISFLKTGPKLLKFIPAQKVQDLRNWLIIYGYWNAGGTENVSAMFWTI
AEKYLDLKIGEIPPVLETPNMGLLHPDSSDYFTSPQQYLTWYQKHSSLKIGQSPIVGILL
YRKHVITKQPYIPQLIRYFEAEGLIPLPIFINGVEGHVAVRDWMTTPYETQQRQQGNIAI
PSLYKEAVEVDSIVSTIGFPLVGGPAGSMEGGRRVEVAKQILTAKNVPYFIAAPLLIQDI
YSWTRQGIGGLQSVVLYALPELDGAIDTVPLGGLVGEDIYLIPERVKRLTGRVKNWIKLR
RKLPSDRKIAIILYGFPPGFGATGTAALLNVPKSLLKFLQELKEQGYTVGNLPEDGEELI
RQVKEADESADERRLTRMDQLSGARVNVKTLEEWLGYLLKSRIEKQWKSLTDTGIKTFGD
EFHIGGVQLGNIWIGVQPPLGLSGDPMRLMFEKDLTPHPQYTAFYKWLQHEFEADAIVHF
GMHGTVEWLPGSPLGNTGYSWSDILLGNLPNLYIYAANNPSESMLAKRRGYGVLISHNVP
PYGRAGLYKELMALRDLIAEFREDPERNYALRDPICQKIVDTGLDADCKFEEGDKLGIDF
TVENARLFSKNALSRYFVKVYEYLQVVEQRLFSSGLHCLGDAPNEEGLRSYLNAFFGEGL
SEWELNQIISRRDSESRRVREGIEIVNLLEQNGDELVNLLRGLNGEYILPAAGGDLLRDG
VGVLPTGRNIHALDPYRMPSPAAFERGREIAQKIIAQHLKEHDKYPETVAVMLWGLDAIK
TKGESLGILLELVGAEPVKEGTGRIVRYELKSIPDVGHPRIDVLANLSGIFRDTFVNIIE
LLDDLFQRASDADEPEEDNFIRKHALALKVQGVENVSARLFSNPAGDFGSLVNDQVVDGN
WESSEELAKTWQGRNSFSYGRKDKGQARPEILAQLLKTSERIVQEIDSVEYGLTDIQEYY
GNTGGLKLAAEKQSGKRVTANFVESFSKDTTPRKLEELLRLEYRSKLLNPKWGQAMANQG
SGGAYEISQRMTALIGWGGTANFTDSWVYDQAADTYALDAEMAAKLRKANPEAFRNIVGR
MIEAHGRGFWNADEEKLQKLQELYELTEDQLEGINN
NT seq 3711 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcatcgtcttaatcgccggatttgaatcctttaacgctgacttgtaccgaaaa
gccgccgagttggctacttctcgctgtccggaattagacatacaagtctttagcgatcgc
gccctcacagaacagccagaaacggtagaaactgccctcaaaaatgctcaagttttcttt
gcgagtctgatctttgattacgatcaggtgatctggttgcgtcaacgagtacaacagatt
cccattcgcctcgtctttgaatctgccctagaattaatgagtttaactcaattaggcaaa
tttgcgatcggtgataaaccaaaaggaatgccgaaaccaattcaatttatcctcagtaaa
ttttccagtggcaaagaagaagataaattagccggatacataagttttctcaaaactggg
ccaaaactcctcaaatttattcccgcccaaaaagtccaagatttacgcaactggttaatt
atttatgggtattggaatgctggcggaacggaaaatgtctccgctatgttttggacaatt
gcggaaaaatatttagatttaaaaataggagaaattcctcccgttcttgaaactcctaac
atgggattactgcatcccgactcttcagactattttacctcaccccaacaatatttaact
tggtatcaaaaacattcctctttaaaaattggtcaatctcctattgttggtattctttta
tatcgtaagcacgttattacaaaacagccttatattccccaattaattcgctattttgaa
gccgaaggattgatcccgttaccgatttttattaatggagtagaaggccatgttgctgtt
agagattggatgacaaccccttacgaaactcaacaacgtcagcagggaaatattgccatt
ccttctctgtataaagaggcggttgaagtggattctattgtgtctaccattgggtttcct
ttagtaggaggccccgccggttcaatggaaggaggcagacgggtagaagttgccaaacaa
attttaacagccaaaaatgtgccttattttatcgctgctcctctcctcattcaagatatt
tattcttggacaagacaaggaattggagggttacaaagtgtcgttttatatgctttaccg
gagttggatggggcaattgatactgttcctttaggtgggttagtcggtgaagatatttat
ttgattcctgaacgggtaaaacgtctgaccggcagggttaaaaattggattaaattaaga
cgtaaattaccgagcgatcgcaaaatagcgataattttatatggatttcctcccggtttt
ggggcaacgggaacggcggctttattaaatgttcccaagtctcttttaaagtttttacag
gagttaaaagagcaaggatatactgtaggtaatttgccggaagatggggaagaattaatc
cgtcaggttaaagaggcagatgagtccgcagatgaacgcagattaacgcggatggatcaa
ttgtcgggggcaagggttaatgttaaaactttagaggaatggttggggtatttgttgaaa
agtcggattgaaaaacaatggaaatctttgacggatacggggataaaaacctttggggat
gagtttcatattgggggagttcaattaggaaatatttggatcggggttcaacctcctttg
ggactttctggtgatccaatgcggttaatgtttgagaaagatttaacgcctcaccctcaa
tatacggcgttttataagtggttacaacatgagtttgaagcggatgcgatcgttcatttt
gggatgcacggaactgtagaatggttgccgggttctcctttgggtaatacgggctattct
tggtctgatattttgttaggaaatctgcctaatctctatatttatgcagctaataatcct
tctgaatcgatgttagctaaacgacggggttatggggtgttaatttctcataatgttcct
ccttacggacgggcaggattatataaggagttgatggcactacgagatttaattgctgag
tttcgagaagatccggagaggaattatgctttacgagatccgatttgtcagaaaattgtt
gatacgggtttagatgcggattgtaagtttgaggagggggataagttagggattgatttt
acggtagaaaatgcgcgtttgtttagcaaaaatgctctttctcgatattttgtgaaggtg
tatgagtatttgcaagttgttgaacagcgtttgttttcttcggggttacattgtttggga
gatgcgccaaatgaggaggggttacgatcgtatttaaatgctttttttggtgaggggttg
tctgagtgggaacttaatcaaattatttcacgcagagactcagagtcacggagagttaga
gaggggatagaaattgtgaatttgttggagcaaaatggggatgagttggttaatcttttg
cgtggattaaatggagaatatattttgccggctgccgggggcgatttgttgcgcgatggg
gttggagtgttgcctacagggcgaaatattcatgctttagatccttatagaatgccttct
ccggctgcttttgagagaggccgagaaatcgctcagaaaattattgctcaacatttaaaa
gaacatgataaatatccggaaacggtggcagttatgttatggggtttggatgcgattaag
actaagggtgaatctttgggcattctgttagaattggtgggggctgaaccggttaaggaa
gggacgggacgaattgttagatatgagttgaaatcaatcccagatgtgggtcatcctcgg
attgatgttttggcgaatttgtcggggatttttagggatacttttgttaatattattgag
ttgttagatgatttgtttcaacgggcttcagatgcggatgagccggaggaagataatttt
attcgtaaacacgctttggctttaaaagttcagggggttgagaatgtatctgcccggtta
ttttctaatccggcgggggattttggctctttggttaatgatcaggttgttgatggaaat
tgggaatcttctgaggaattagctaagacttggcaaggtcgtaatagttttagttatggg
agaaaagataagggacaagctagaccggaaattctggctcaattgttaaaaaccagtgaa
agaattgtacaggaaattgattctgttgagtatgggttgacggatattcaagagtattat
ggcaatacgggaggcttaaaactggcggcagaaaaacaaagcggaaaacgagtaacggct
aattttgttgaaagtttttctaaagatactaccccaagaaaattagaagagttattaagg
ttagaatatcgcagcaaattgttaaaccctaaatggggtcaagctatggctaatcaaggc
tctgggggggcttacgaaatttctcaacgcatgacggctttaattggttggggaggtact
gctaattttactgatagttgggtttatgatcaagccgcagatacctatgctttagatgct
gaaatggccgccaaattacgtaaagctaaccctgaagccttccgtaatattgtcgggcgt
atgatagaagctcatgggcgtggtttttggaatgctgatgaggaaaaattacagaagtta
caggagttatatgagttaactgaagatcaactcgaaggcattaataattaa

DBGET integrated database retrieval system