KEGG   Cyanothece sp. PCC 7424: PCC7424_4156Help
Entry
PCC7424_4156      CDS       T00808                                 

Definition
acireductone dioxygenase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyc00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    PCC7424_4156
Enzymes [BR:cyc01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     PCC7424_4156
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     PCC7424_4156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4603456..4604010
Genome map
AA seq 184 aa AA seqDB search
MAILRLENGVTYTKLEDIERELAPLNVQLNYWTVGDDSNLRHLLAKEALSDSEKEQVLHA
LDHYFEQLKETEGYQSRDLIVLNPNIPNLDTLLSKFEQCHTHADDEVRYIIDGEGVFGFV
RPDGLQLELTIQPEEYINVPAGAEHWFHLTETKRIKAVRYFITTEGWVPEYTNTPIRFPA
LVTQ
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggctattttacggttagaaaatggggtaacttacaccaagttagaagatattgaacgg
gagttagcccctctcaacgtacagttaaattattggacagtgggcgatgattctaatctt
cgtcatttactcgccaaagaagctttatcagactcagaaaaagagcaagttttacacgct
ttagatcattattttgaacagcttaaggaaacagagggttatcaatcccgggatttgatt
gtacttaatcctaatattcctaatttagacactcttttatccaaatttgagcaatgccac
acccacgcagatgatgaagttcgttatattattgacggtgagggagtgtttggttttgtt
cgtcctgacgggttgcaattagagttaactattcaaccagaagaatatattaatgttcct
gccggtgctgaacattggtttcatttaaccgagacaaaacgcattaaagcggtgcgttat
tttattacgacagaaggatgggttccggaatatactaatacccctattcgattcccggct
ttagtgacacagtaa

DBGET integrated database retrieval system