KEGG   Cyanothece sp. PCC 7424: PCC7424_4273Help
Entry
PCC7424_4273      CDS       T00808                                 

Definition
alpha amylase catalytic protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:cyc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PCC7424_4273
Enzymes [BR:cyc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     PCC7424_4273
Exosome [BR:cyc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PCC7424_4273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4741689..4743320)
Genome map
AA seq 543 aa AA seqDB search
MSKSIDFQLFAPYNQEAVLIGSFSEWQPIPMKKDDKGYFRTEVKLEDGEYEYKFRVRSKS
WFLEPDQWVYIVDPYATKVIDNSEQNGIICIKDGQKFVDTYVWQHDDKPLPQNHELVIYE
MHIPSFGGGNYQQAIEKLDYLSDLGINAIQLMPVQEYAGEDNWGYLARYFFAAESSYGST
EELKHFIDECHGRGIRVFMDMMLNHSEQSSPLTQIDHNYWYHHEARDPQNSWGPEFNYEH
YDENLDIKPAWNFAGDVVRFWIEEYHIDGIRYDAARQLANYDFMHWIVEETKKTAGSKPF
YNIAEHIPDTPNITNFDGPMDGCWHDSFYYLVTPAIWGDSFDLEDLKKAIDCKLDGYMGV
TNVINYLSNHDKERLMISLGERNIFDDAAFKKAKLGAVLVMTAIGLPMIWMGEEFGNSQN
KQMEHPSEIDWSLLNNERNLGLLEYYKGLIQLRKNNPAFFTENVDFFHENSETKVFVYGR
WNDEGSRVVVVANFSENYLAGYVVPEFPADGTWHEWTRDYDVEVKDRQLMIDLAEYEAQV
FIN
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaatctattgattttcaactgtttgcaccttataaccaagaagcagttttaatc
ggttctttttctgagtggcaacctatccccatgaaaaaagatgacaaaggatatttccga
accgaagtcaaattagaagacggggaatatgaatataagttccgagttcggtctaaaagt
tggtttcttgagccggatcaatgggtttatatagttgatccttatgccactaaagttatt
gataattctgagcaaaatggaattatttgtattaaagacggtcaaaaatttgttgatact
tatgtttggcaacatgacgataaaccattaccccaaaatcatgaattagttatttatgaa
atgcacattccttcttttggagggggaaactatcaacaagctattgaaaagttagattat
ctttctgatttaggaattaatgccatacaattgatgccggttcaagaatatgcaggagaa
gataattggggttatcttgctcgttatttttttgcggctgaatctagttatggttcaacc
gaagaattaaagcattttattgatgaatgtcatgggcgaggaattcgagtttttatggat
atgatgttaaatcattccgaacaatctagtcctttaacgcaaattgatcataattattgg
tatcatcatgaagcacgagatccgcaaaattcctgggggcctgaattcaattatgagcat
tatgacgaaaatctagacattaaacccgcttggaattttgccggggatgtagtacggttt
tggattgaagaatatcatattgatggcattcgttacgatgcagcgcgacaattggctaat
tatgattttatgcactggatagttgaagaaactaaaaaaacggctggttcaaagcccttt
tataatattgcagaacatattcccgatactcctaatattactaattttgacgggccgatg
gatggctgttggcatgacagtttctattatttagttactccggctatctggggagatagt
tttgatttagaagacctcaaaaaagccattgattgtaagctagatggctatatgggagtc
actaatgttattaattatttgtctaatcatgataaagaaagattgatgatttctttgggg
gaacgtaatatttttgatgatgctgcttttaaaaaagctaaattaggagcagttttagtc
atgacagctatcggtttaccgatgatttggatgggggaagaatttggaaattctcagaac
aagcaaatggagcatccgtctgaaattgattggagtttattaaataatgaacgaaattta
ggattattagaatactataaaggattaattcaactgcgaaaaaataatccggcatttttt
accgaaaatgttgatttttttcatgaaaattcagagacgaaagtttttgtctatggtcga
tggaatgacgaaggcagtagagtcgtggttgtggctaatttttcggaaaattatttagct
ggatatgtcgttcctgaatttccagccgatgggacttggcatgagtggacaagggattat
gatgtggaggtaaaagatcggcaattaatgatagatttagctgaatatgaagcccaagtc
tttattaattaa

DBGET integrated database retrieval system