KEGG   Cyanothece sp. PCC 7424: PCC7424_4362Help
Entry
PCC7424_4362      CDS       T00808                                 

Definition
1,4-alpha-glucan branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cyc00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4836376..4838340
Genome map
AA seq 654 aa AA seqDB search
MAQSELIQYSLFSDLDFYLFGEGKHYQIYEKLGAHPVEFEGVTGTYFALWAPKAVAISVV
GDFNDWKLDHHPMKRNQMGIWELFIPSVSIGEKYKFAIKNHQQHSIFKTDPYGYQQELRP
ATASIVTDLSYDWGDRDWLNHRHHSNPHTQPISVYEVHLGSWLHQSWETPPENGVAVSVP
HKPGARFLTYRELADKLIPYVKKMGYTHIELLPITEHPFDGSWGYQVVGYFAPTSRYGTP
QDFMYFVDQCHQNNIGVILDWVPGHFPKDEHGLALFDGTHLYEYADPRMGEHKGWGTLVF
NYSRHEVRNFLISSAVFWFDKYHIDGIRVDAVASMLYLDYEREPGQWMTNPYGGRENLDA
VEFLRQLNHAIFNYYPGVLSIAEESTTWEGVSRPVDAGGLGFNFKWNMGWMNDTLRVFQV
NSSDRSNVYNTITFSIWYAFTENFMLALSHDEVVHGKGHLFQKIPGDHPHKLANLRLLFA
YMFTHPGKKTLFMGMELGQTREWNVNGDLDWWLLEQDPHQKLQQLVQYLNYLYQNEPALY
SDDFTNDGFEWIDCHDHARGLISYLRKDKYSGETIITVCNFKPNAYHNYWVGVRHPGTYI
QLLNTDSQVYGGNGLENPLKIQTRQWNSHPWPYALEVNVPPVSCCAFKLGIMSY
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaagtgaacttatccaatacagcttattcagtgaccttgatttttatctgttt
ggagaaggaaaacattaccagatttatgaaaaattaggagcgcatcccgtcgaatttgag
ggagtaacagggacatattttgcactgtgggcccctaaggcggtagctatttccgttgtc
ggtgatttcaacgactggaagcttgaccatcaccctatgaaacggaatcagatgggaatt
tgggaattatttattccgtctgtgagcatcggagaaaaatataagtttgccattaaaaat
catcagcaacactcgatctttaaaactgatccctacggctatcaacaagaactccgtccg
gctactgcctcaattgtgacagatttatcctatgattggggcgatcgagactggctcaac
catcgtcatcacagtaacccccacactcaaccgatttccgtctatgaagtgcatttaggg
tcttggttgcatcaaagttgggagacccctccagaaaacggagtagctgtgagtgttccc
cataaacccggagcaagatttttaacctatcgagaattagccgacaaactgattccttat
gtcaaaaaaatgggttatacccatattgaacttttgccgatcacagagcatccttttgat
gggtcttggggttatcaagtagtgggttattttgctcccacgtctcgttatggcacacct
caagattttatgtattttgtcgatcaatgtcatcaaaataatattggagttattttagat
tgggttcctggacattttcctaaagatgaacatggattagctttgtttgatggaactcat
ttgtatgaatatgctgacccccgtatgggagaacataaagggtggggaacattagttttt
aattatagtcgtcatgaagtccgtaattttttaatttctagtgctgtgttttggtttgat
aagtatcatattgatgggattcgagttgatgcagtcgcttcaatgctttatctagattat
gaacgagagcccggtcaatggatgactaatccctatggaggacgggaaaatttagacgcg
gtagaatttttacgtcagttaaatcacgccatctttaattattatcctggggttctttct
attgctgaagaatccaccacttgggaaggagtttcacgacccgtagatgccggcggatta
ggctttaatttcaaatggaatatgggttggatgaacgatactttaagagtatttcaggtt
aattcttctgaccgttctaacgtttacaatactattacttttagtatttggtatgctttc
acagaaaactttatgctagccctttctcatgatgaagtcgttcatggtaaaggtcattta
ttccaaaaaattcccggagatcatccccataaattagctaatttacgcttactctttgcc
tatatgtttacccatccaggtaaaaaaactttatttatgggaatggagttgggtcaaacc
agagaatggaatgtcaatggggatctagactggtggttattagaacaagaccctcatcaa
aaattgcaacaattagtgcaatatctcaattatctctatcaaaatgagccggcactttat
agcgatgattttactaatgatgggtttgaatggatagactgtcacgatcacgctagaggg
ttaatctcttatctgcggaaagataaatattccggggaaacaatcatcacagtttgtaat
tttaaacctaatgcttatcataactactgggtaggagttcgtcatccgggtacttatatt
caattacttaatactgattcccaagtttatggaggtaatggattagaaaatcccttgaaa
attcaaacccgtcaatggaattcccacccttggccttatgcacttgaagtcaatgtccct
cctgtaagctgttgtgcatttaaactgggtattatgagctattga

DBGET integrated database retrieval system