KEGG   Cyanothece sp. PCC 7424: PCC7424_4466Help
Entry
PCC7424_4466      CDS       T00808                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
cyc00900  Terpenoid backbone biosynthesis
cyc01100  Metabolic pathways
cyc01110  Biosynthesis of secondary metabolites
cyc01130  Biosynthesis of antibiotics
Module
cyc_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:cyc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PCC7424_4466
Enzymes [BR:cyc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     PCC7424_4466
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ACK72830
JGI: PCC74244466
UniProt: B7K961
Position
complement(4950227..4951177)
Genome map
AA seq 316 aa AA seqDB search
MHAYTLIAPGKINLYLEIIGDRPDGYHELIMILQSIDLADRITLRPNGVQQFRLYCSHPQ
VPTDESNLAYRAAKLMQQEFPKQFDNFGGVDITIDKRIPVAAGLAGGSTNGAAVLVGLNL
IWQLGLTQPELQGLASLLGSDVPFCVSGGTAIATGRGEQLDPIYDLDNLWVVLAKYTSIA
VSTPWAYKTYRQLFNNTYISDRERIQARTHQVHAGPLMGAILQKDGAKIGRLLHNDLEKV
VLPEYPQVAHLRETMAKMGGFGTMMSGSGPTVFTLCESYAQAEKIKQHIRENISDIDLQL
WVAQLSNMGIQVEIAG
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcctatactttaattgctcccggaaaaattaatctgtatctagaaataattggc
gatcgcccagatggttatcatgaattaatcatgatcctccaaagcattgacttagcagac
cggattaccctacggcctaacggagtgcaacaattccggctgtactgctcccatccccaa
gttcccacagatgagagtaacctagcttaccgggcggcgaaattaatgcagcaagaattt
ccgaaacagtttgataattttgggggagtagatattaccattgacaaacggataccggtg
gctgccggattagccggagggtcaacgaatggggcggcggtattagtgggattaaactta
atttggcaattaggactgactcaacccgaattacaaggattagcctcgctgttggggtct
gatgtgccgttttgcgtgtctggagggacagctatagcgaccggacgaggagaacagtta
gatccgatctacgatttagataatctttgggtagttttggctaaatataccagtatagct
gtctctactccttgggcttataaaacctatcgtcaactcttcaataatacttatattagc
gatcgagagagaatccaggcgagaactcatcaagttcatgcagggcctttgatgggggca
attcttcagaaagatggggctaaaataggcagattattacataatgatttagaaaaagtc
gttttacccgaatatccccaagttgctcaccttcgagagacaatggcaaaaatgggagga
ttcggaacgatgatgtccggttcagggccgacggtgtttactctatgtgaatcttatgct
caggctgaaaaaattaaacaacatattagagaaaatatatctgatatagacttacaatta
tgggtggcgcaattatcaaatatgggcattcaggttgaaatcgccggttaa

DBGET integrated database retrieval system