KEGG   Cyanothece sp. PCC 7424: PCC7424_4475Help
Entry
PCC7424_4475      CDS       T00808                                 

Definition
(GenBank) Holliday junction DNA helicase RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
cyc03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cyc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PCC7424_4475
Enzymes [BR:cyc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     PCC7424_4475
DNA repair and recombination proteins [BR:cyc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     PCC7424_4475
    RecFOR pathway proteins
     PCC7424_4475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH HHH_2 HHH_3 HHH_4
Motif
Other DBs
NCBI-ProteinID: ACK72839
JGI: PCC74244475
UniProt: B7K970
Position
complement(4957317..4957946)
Genome map
AA seq 209 aa AA seqDB search
MINYLKGKTTQILKTPSNRNILILEVNHIGYEIQIPSRLARNLSLEEDQIVQIFTHLQIR
EDQQILYGFSTDSERDLFRQLININGVGTQTAIALIDTLGIEALINAIVTNDVKTLSKTP
GVGPKTAERIALELKSKLSQWEQAIALKTPVSVGVPSREILEEVEMTLLALGYTDEEIDQ
AISAISQDNLLLKNPHVEEWLKSAIAWLS
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgatcaattatctcaaaggcaagacaacccaaattctcaaaaccccctctaatcgaaac
attttaattttagaggtgaatcacattggttatgagatccaaattccctcccgtcttgcc
cgaaatttatcactagaagaggatcaaatcgttcaaatttttacccatctgcaaattcga
gaagatcagcaaattctctatgggttttctactgactcggaaagagacttatttcggcag
ttaattaatattaacggcgttggcactcaaaccgcgatcgctttaatcgatacattaggg
atagaagcgttaattaatgccattgttaccaatgacgtaaaaaccctttctaaaacccca
ggagtcgggccaaaaacggctgaacggatagccttagagttaaaaagtaaattgtctcaa
tgggaacaggcgatcgccctcaagacaccggtttctgttggtgttccttccagagagatt
ttagaagaagtagaaatgaccctgttagccttgggatataccgatgaagaaatcgatcaa
gcgatatccgctattagtcaagataacctactcctgaaaaatcctcacgttgaagaatgg
cttaaaagtgcgatcgcttggctgagttaa

DBGET integrated database retrieval system