KEGG   Cyanothece sp. PCC 7424: PCC7424_4596Help
Entry
PCC7424_4596      CDS       T00808                                 

Definition
glycoside hydrolase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PCC7424_4596
Enzymes [BR:cyc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     PCC7424_4596
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5088949..5090085
Genome map
AA seq 378 aa AA seqDB search
MMKFIIFRNPQQWILALLFLLTILASKSLSAPPDQPINPWTLRNMMGRGVNMKAALGGKH
NWWIKYNPKHGEAIQKAGFNSVRVWFFWAGLNSGSPDYTLSPAALEDMENIINDLLNRNL
VVVLVPMELGNYGEKNLTTNPSAHKAKYLSIWKQLADRFRNHSHRLVFDLFNEPHGELGK
KELNDWHESVVPIIRKTNPTRVLIFNGDDWGTASTLKNIIIPPEAGQYVMGDFHYYWPMG
FTHHGNQAWTGTVEQKNRVRVEFNKAVAWSKKYDIPVVCTEWGSNNIRSLSEREAYHLFI
RDELLVRGFSYQQYAFSDGQFKMYDGFKHQWVYPTLRDIAVAGDASWEVSASKPDHRPKW
KQYLANLRFDFLFKYLFF
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaatttattatttttagaaaccctcaacaatggattttagccttattatttttg
ctaaccatcttagcctcaaaaagtctttcagcccctcccgatcaaccgataaatccctgg
actctcagaaatatgatgggtcgaggagtaaatatgaaagccgctttaggaggtaaacac
aattggtggattaaatataatccgaaacatggagaagcgattcaaaaagctggatttaat
tctgtccgagtctggtttttttgggcaggacttaacagtggttctcctgactataccctt
tctccggctgctttggaagatatggaaaatatcattaatgatttattaaatcgtaattta
gtagtggtattagttccaatggaattgggaaattatggagagaagaatttaaccactaac
ccatctgctcataaagcaaaatatttgagtatttggaaacaactggcagaccgttttcgc
aatcattctcatcggttagtgtttgatttatttaacgaacctcatggagaactcggcaaa
aaagaactcaatgactggcatgaaagtgtagttcccattatccgaaaaactaatccaact
cgtgtattaatcttcaatggtgatgattggggaacagcaagcactcttaaaaatatcatt
attccgccagaagcaggtcagtatgttatgggcgactttcattattactggcctatggga
tttactcatcatggaaatcaagcatggacgggaacagttgagcaaaaaaatagagttcga
gtagaatttaacaaggcagtagcttggtcaaaaaagtatgatattcctgttgtttgtacc
gaatggggatctaacaatattcggtctctttcagagcgagaagcttatcatcttttcatt
cgggatgagcttcttgtaagaggtttttcttatcagcaatatgctttcagtgatggtcaa
ttcaaaatgtatgatggatttaaacatcaatgggtttatcctactcttcgtgatattgct
gtagcgggggatgcttcttgggaagtttccgcctcaaaacccgatcatcggcctaagtgg
aaacaatatcttgctaatttgagatttgattttctgttcaaatatctttttttctag

DBGET integrated database retrieval system