KEGG   Cyanothece sp. PCC 7424: PCC7424_4745Help
Entry
PCC7424_4745      CDS       T00808                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cyc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PCC7424_4745 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PCC7424_4745 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PCC7424_4745 (trpA)
Enzymes [BR:cyc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PCC7424_4745 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5264839..5265639)
Genome map
AA seq 266 aa AA seqDB search
MTSVSHCFKTLRDRGECALIPFITAGDPDLETTAKALSVLAQSGADIIELGVPYSDPLAD
GPVIQAAATRALNRGVKLEGVLKLVEDFTKEYKTPIVLFIYYNPIYYRGVDSFLAQIAAA
GVKGLVVPDLPLEEADNLLKPASEMGIEVTLLVAPTSPIERIKAIAQQSQGFTYLVSVTG
VTGVRSQVASRVKELIASMRTVTDKPIGVGFGISTPEQALQVKQWGADAVIVGSAIVKRL
AENPPEAGLKSIAEFCHSLKQAIING
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgacctcggtttcccactgttttaaaactctacgcgatcgcggagaatgtgccctcatt
ccttttatcaccgcaggagatccagatttagaaaccaccgccaaagctttgtctgtttta
gcccaatcaggagcagatatcatcgaattaggcgttccttactctgatcctctcgcagat
gggccggttattcaagccgccgctactcgcgccttaaaccgaggagttaagttagaagga
gtgttaaaattagtcgaggattttaccaaagagtataaaacgcccattgtactttttatt
tattataatccgatttattatcgaggggtagactcttttttggcacaaatcgcagcagcc
ggggttaaagggttagttgtgcccgatttacccctagaagaagccgacaatttactgaaa
cccgcctcagagatgggaatagaagtgactttgttagttgctcctaccagtccaatagag
aggataaaagcgatcgctcaacagtctcaagggtttacctatctggtgagtgtgactgga
gtaacgggagtgcgatcgcaagtagccagtagagttaaagagttaattgcttctatgcga
actgtaaccgataaaccgattggagtggggttcggaatttctacccccgaacaagcttta
caagtgaaacaatggggagcagatgcggttattgtgggaagtgcgatcgtaaagcggtta
gcagaaaatccccccgaagccgggttaaaatcaatagcagagttttgtcacagtttgaaa
caagctattatcaatggataa

DBGET integrated database retrieval system