KEGG   Cyanothece sp. PCC 7424: PCC7424_4754Help
Entry
PCC7424_4754      CDS       T00808                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:cyc00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5274894..5275877
Genome map
AA seq 327 aa AA seqDB search
MVAYEKEQQIAIAAVTVAAGLCQRVRQLENWATLTKADTSPVTIADFATQAVICQALSVA
FPDDPIIGEEDAALLVLPELAEALGQITHQVQTILPEASSQQVIDSINRGKGKIASRYWT
LDPIDGTKGFIRGDQYAIALALVEAGEVKLGILGCPALPVDFNDPQGDLGVIFLGIRGQG
SQMRSIDGKKSHPITVNRTDEPGNIQRIESVEYTHSDRTRQKALDQTLGVKHPVKQMDSL
AKYGAIARGEADLYVRIPLQQPTPRYENIWDHASGVVIVEEAGGKVTDLDGKALDFSVGP
KLSNNRGIVVTNGKIHQQVLETIAQTT
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggtagcttacgaaaaagaacagcaaatagcgatcgcagccgtaaccgtcgccgccgga
ctttgccaaagagtgcgccaactggaaaattgggctaccctgacaaaagcggataccagt
ccggtgactattgctgattttgccactcaggcggtcatttgtcaggcgttatcggtggct
tttcccgatgatcccattattggagaagaagacgcagcacttttagtcttgccggaatta
gccgaagcgttagggcaaattacccaccaagttcaaacgatccttccagaagcctcatca
caacaagttatagactcgattaatcgaggaaagggtaaaattgcctctcgttactggaca
ttagatccgatcgatgggacaaaaggttttattcgaggggatcaatatgccattgcttta
gctttagtggaagcaggggaagtgaaattaggaattctcggatgtccggctttacccgtc
gatttcaatgatcctcaaggggatctaggggtgatttttctgggaattcgagggcaagga
agtcaaatgaggtctattgatgggaaaaaatctcacccaattaccgttaatcggacggat
gaacccggaaacattcagaggattgaaagtgtagaatacacccatagcgatcgcactcga
caaaaggcgttagatcaaaccttgggggtaaaacacccggttaaacagatggactctctc
gctaaatatggggcaattgccagaggagaagcagatttgtatgtgcgaattcccttacag
caaccgacaccccggtatgagaatatttgggatcatgcttctggtgtggttattgtcgaa
gaagccggtgggaaagtgactgacttagacgggaaagctctagatttttctgtggggcct
aaattaagtaataatcggggaattgtggttactaatgggaaaatccatcaacaagtgtta
gagacgatcgcccaaacgacttaa

DBGET integrated database retrieval system