KEGG   Cyanothece sp. PCC 7424: PCC7424_4956Help
Entry
PCC7424_4956      CDS       T00808                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PCC7424_4956
Enzymes [BR:cyc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     PCC7424_4956
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5504744..5506240
Genome map
AA seq 498 aa AA seqDB search
MPFPRSSGILLHPTSFPSRYGIGDLGIEAYYFIDFLVRSGQRYWQILPLNPPSVGNSPYM
SFSAIAGNPLLISPDLLLEKGLLNPEDLENVPDFPLDHIDFEGVIAWKIPLLKKASQNFA
QKASPVMQRRFEGFCQGKAGWLEDYALFMALLESQGQPVWTQWPIELRNRYQDALDYARQ
ELKEEIFFHKFLQFEFLEEWLALRGYINTLNIQIIGDIPIYVGHNSADVWANPQVFKLDP
ETGNPLEVAGVPPDYFSATGQLWGNPIYDWEYLQNTGFDWWVRRVREVLTQVDIVRIDHF
RGLESYWSVPAGETTAMNGQWVKAPGYALFDTIRTKLGKLPIIAEDLGDIDQPVLDMRDH
YEFPGMKILHFAFGGGSDNPYLPFNVDRNSVIYTGTHDNNTSMGWYYDNANDYEKGRLYQ
YLGCTGDYSIAWDMIRLAYSSVANQAIIPLQDVFSLGSDARMNTPSLADGNWSWRYRGEA
LTEEYINRLREMVMLYGR
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgccctttcctcgctccagtggcattttactccatcctacaagctttccgagtcgctac
ggtatcggagatttagggatagaagcctattattttattgactttttggttcgcagtgga
cagcgctattggcaaatactccccttaaatcctcctagtgtgggcaactctccctatatg
agtttttccgccattgccggcaatcctttattgattagtccggatttgctcttagaaaaa
ggattactcaacccagaagatttagagaatgtgccggactttcccctggatcatatcgat
ttcgagggggtgattgcttggaaaattcccctcctcaaaaaagcctcccaaaactttgct
caaaaagcatccccagtgatgcaacgcagatttgaaggattttgtcaaggcaaagccggc
tggttagaagattatgccctattcatggctttattagagtctcaagggcaaccggtttgg
acacaatggccgatagaattacgaaatcgctatcaagatgccctagactatgcccgtcaa
gaattaaaagaggaaatctttttccataagttccttcagtttgaatttttggaagagtgg
ttagccctcagaggctatattaacaccctcaacattcaaattattggagatattcccatc
tatgtcggtcataatagcgctgatgtttgggccaacccccaagtctttaaactcgatccg
gaaaccggcaaccccttagaagtagccggagttcccccagattatttttccgctactggg
caattatggggcaatcctatctatgactgggaatacctccaaaatacaggctttgattgg
tgggtgcgccgagttcgggaagtgttaacccaagttgatattgttcggatcgatcacttc
cgagggttagaatcatattggtcagttccggcgggagaaaccaccgctatgaacggacaa
tgggtgaaagccccaggatatgccttatttgacactattcgcactaaattaggtaaactc
cccatcatcgctgaagatttgggcgatatcgatcaaccggtgttagatatgcgggatcat
tacgaattccccggcatgaagatcttgcactttgcctttggagggggatcggataatccc
tatttaccctttaatgtcgatcgcaatagtgtaatttacaccggaactcatgataacaat
acctcaatgggttggtactatgacaatgccaatgactatgaaaaaggtcgtttgtatcaa
tatctggggtgtaccggagactatagcattgcctgggatatgatccgtttagcttatagt
tctgtagctaatcaggcgattattcctctacaagatgtgtttagtctcggatcggatgca
agaatgaatacccctagtctagctgatggtaactggtcatggcgttaccgaggggaagcg
ttaaccgaagagtatatcaatcgtcttcgagagatggtgatgctttacggacggtaa

DBGET integrated database retrieval system