KEGG   Cyanothece sp. PCC 7424: PCC7424_5245Help
Entry
PCC7424_5245      CDS       T00808                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:cyc00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PCC7424_5245
Enzymes [BR:cyc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     PCC7424_5245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5823116..5824306
Genome map
AA seq 396 aa AA seqDB search
MSSNNFQPPNSQFNGHSSEAQRALEKEAKLPLTGWQQEVNQGLEYGLEAAESINDRSIPT
FSRGELPHYAGINTFLKAPYLEDVRQVGNYDVAIVGVPHDSGTTYRPGTRFGPQGIRRIS
ALYTPYNFELGVDLREQITLCDVGDIFTIPANNEKSFDQISKGIAHIFSSGAFPIVLGGD
HSIGFPTVRGVCRHLGDKKIGIIHFDRHVDTQETDLDERMHTCPWFHATNIKNAPAKNLV
QLGIGGWQVPRQGVKVCRERATNILTVTDITEMGLDAAVDYAVERATDGTDCVWISFDID
CIDAGFVPGTGWPEPGGLLPREALYLLGKIVQRVPVCGLEVVEVSPPYDISDITSLMATR
VICDTMAHLVLSGQLPRQEKPAYIHPEAQTEATPWS
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagttccaataattttcaaccccctaacagtcaatttaacggtcattcctcagaagct
caacgtgccctagaaaaagaagcaaaactgcctctaacgggatggcaacaggaagtcaat
caaggattagaatatggattagaagcagcagagagtattaacgatcgcagtattcctacc
ttttctcgcggagaactgccccactatgccggcattaatacgtttttgaaagcgccctat
ttagaagatgtgcgtcaagtgggaaactatgatgtagcgatcgtcggtgtccctcatgat
tctggcacaacttaccgccccggaacccgtttcgggcctcaaggtatccgtcgcatatcc
gccctttataccccttataattttgaattaggggttgatttgcgcgaacaaattacccta
tgtgatgtaggggatatttttaccattccagctaataacgaaaagtcttttgatcaaatc
tcaaaaggaattgctcatatttttagttcgggagcatttcccattgttttaggaggggat
cactccattgggtttcctacggttcgaggagtctgtcgtcacttaggagacaaaaaaatc
ggcatcattcacttcgatcgccacgtagacacccaagaaaccgacttagacgaacggatg
cacacttgtccctggtttcacgccaccaatattaaaaatgcccccgctaaaaatttagtg
caattagggatagggggttggcaagttccgcgtcaaggggtgaaagtttgtcgagaacga
gctactaatattttaaccgttaccgacattacagaaatgggattagatgcggcggtagat
tatgcggtagaacgggctaccgatgggactgactgcgtttggatcagttttgatattgat
tgtattgatgccgggtttgtgccgggaacgggttggccggaaccgggggggttattaccg
agagaagcgctttatctattgggtaaaatcgtgcaacgggtgccggtatgtgggttagaa
gtggtggaagtttctcccccctatgacattagtgatataacctcattgatggcaactcgt
gttatttgtgatacgatggcgcatttggtattatccggacaacttccccgtcaagaaaaa
ccggcttatattcatcccgaagcgcaaacggaagctaccccttggagttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system