KEGG   Cyanothece sp. PCC 7424: PCC7424_5352Help
Entry
PCC7424_5352      CDS       T00808                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
cyc00010  Glycolysis / Gluconeogenesis
cyc00052  Galactose metabolism
cyc00500  Starch and sucrose metabolism
cyc00520  Amino sugar and nucleotide sugar metabolism
cyc00521  Streptomycin biosynthesis
cyc01100  Metabolic pathways
cyc01110  Biosynthesis of secondary metabolites
cyc01120  Microbial metabolism in diverse environments
cyc01130  Biosynthesis of antibiotics
cyc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cyc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PCC7424_5352
   00052 Galactose metabolism
    PCC7424_5352
   00500 Starch and sucrose metabolism
    PCC7424_5352
   00520 Amino sugar and nucleotide sugar metabolism
    PCC7424_5352
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PCC7424_5352
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    PCC7424_5352
Enzymes [BR:cyc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PCC7424_5352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ACK73699
JGI: PCC74245352
UniProt: B7KJM2
Position
complement(5939488..5940384)
Genome map
AA seq 298 aa AA seqDB search
MTNQTVIGIDLGGTAIKLGKFLSDGICLETITIPTPQPATPQAVLESIVTVVKQLNQDHN
CLAIGLGTPGPADAGGRIAKVAINLSGWLDVPLADWLEKETNLPTIIANDANCAGLGEAW
LGAGRNFKNLILLTLGTGVGGAIILDGKLFTGHNGAAGELGLITLNPDGFPCNSGNQGSL
EQYASIGGIRRQTGKEPIELGKLAQEGDPTALAFWRQYGQILGIGLTSLIYVLTPEAVII
GGGISASAKFFFPAMQEEIERRVLPICREGLQLFSAELGNNAGMIGAAKLAWQNLVMR
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgactaatcaaaccgttatcggcatagatttagggggaactgcgattaaactgggtaaa
ttcctcagtgatggaatttgtttagaaaccatcaccattccaactccccaacccgctacc
cctcaagcagtattagaaagtatcgtgacagtcgtcaaacaactcaatcaagatcataat
tgtttggcgatcgggttaggaacgcccggcccggctgatgcggggggtagaattgctaaa
gtcgccattaatctatccggttggttagatgttcccctagctgactggttagaaaaagag
acgaacttaccgactattatcgctaatgatgccaattgtgccggtttaggagaagcgtgg
ttaggcgctggcagaaactttaaaaatttaattttattaacgttaggaacaggagtcggt
ggggcaattattctggatggtaaattatttaccggtcataatggggcagccggagaatta
ggattaattaccttaaaccctgacggattcccctgtaacagtggaaatcaaggatcatta
gaacaatatgcctcaattggaggaattcgacgacaaaccggcaaagaaccgatagaatta
ggaaaattggcacaagaaggtgatccgacggccttggctttttggcgacaatatgggcaa
attttaggcatcggattaaccagtttaatctatgtgttaacccctgaagcggttattatt
ggcggcggaattagcgcctcagctaaatttttctttccggcgatgcaagaagaaattgaa
cggcgagttttacccatttgtcgggaagggttacaattattttccgcagaattaggcaat
aatgccggtatgatcggggcagccaaattagcttggcaaaatctagtcatgagataa

DBGET integrated database retrieval system