KEGG   Cyanothece sp. PCC 7424: PCC7424_5567Help
Entry
PCC7424_5567      CDS       T00808                                 

Definition
stearoyl-CoA 9-desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cyc00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    PCC7424_5567
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PCC7424_5567
Enzymes [BR:cyc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     PCC7424_5567
Lipid biosynthesis proteins [BR:cyc01004]
 Desaturase
  First
   PCC7424_5567
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pP742403:complement(17860..18702)
Genome map
AA seq 280 aa AA seqDB search
MTSNFLEAPTVGEQSLRVNWVSVGFFGAAHAVVLLAPWFFSWSALGIAIFFHWLTGSIGI
CLAYHRLLTHRSFQVPKWLEYILAMIGGLALQGGPIFWVAGHRLHHAHTEDIDKDPYSAQ
RGFWWSHILWLFYDRKEFFDYETYKRFAPDLARDPFYRWLNRYYLLLQIPVGFVLYLLGG
WSFVIYGIFVRAVLLWHSTWLINSATHMWGYRTFDSKDNSRNLWWAAIITYGEGWHNNHH
AHPNVVKAGLKWWEIDMTWWAIQTLKSLGLAKKLVLPMAN
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgacatcgaattttcttgaagctcccacagtaggggagcaatcgctcagggtaaactgg
gttagtgtaggtttctttggagcggctcacgcggtagttttgttagccccttggtttttt
tcttggtctgccctcggaatagcaatatttttccattggctcaccggtagtataggcatt
tgtttagcctatcaccgtctgctgactcaccgcagttttcaagttcccaaatggcttgaa
tatattttggcaatgattggcggattggcattgcaaggtgggccgattttttgggtagcc
ggacatcgcttgcatcatgctcacaccgaagatattgataaagatccttactcagcccaa
cgggggttttggtggagtcatatcctctggttgttttacgaccgtaaagaattttttgac
tacgaaacttataagcgatttgctccggatttagcacgagatcccttttatcgctggctc
aaccgttattacttactgcttcagattccggtaggatttgtactgtatctgcttggcggt
tggtcttttgtcatctatggcatatttgtcagagccgttttactttggcacagcacttgg
ttaattaactcggccactcatatgtggggttatcgcacctttgactcgaaagataattcc
cgtaacctctggtgggctgcgattatcacttacggagaaggctggcataataaccatcac
gctcatcctaatgtggtcaaagccgggttgaaatggtgggaaattgacatgacgtggtgg
gcgattcagactttaaagagtttgggtttagctaaaaagcttgtgcttcctatggccaac
tga

DBGET integrated database retrieval system