KEGG   Cyanothece sp. PCC 7424: PCC7424_5791Help
Entry
PCC7424_5791      CDS       T00808                                 

Definition
asparagine synthase (glutamine-hydrolyzing)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cyc00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PCC7424_5791
Enzymes [BR:cyc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     PCC7424_5791
Peptidases [BR:cyc01002]
 Cysteine Peptidases
  Family C44
   PCC7424_5791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pP742401:216645..218528
Genome map
AA seq 627 aa AA seqDB search
MCGIAGIYNYSESFSLDEIRKNICQMTDALTHRGPDDHGVWCQENIALGHRRLSILDLSP
LGGQPMFSNDRNIVTVFNGEIYNFQELKRELEKDYSFQSQTDTEVIIAAYKKWGEACVEK
FSGMFAFALWDISKNSLFLARDHLGIKPLYYYQTNGLLLFASEIRSLLATSLIKRSIDPI
SLKLLLSYQTVPAPRSILQDVQILLPGNALIIKNGQVKQWCYWKPNHYVINKPIIDYEKS
IQIQVAERLQTAVKNHLVSDVPLGVFLSGGIDSSTLVGLARQASLEDIHTVSIIFDEPEY
NELSYISQVAERFQTQHTNVHLSSTDLLKQLPKFLEDLDRPTGDGVNSYVVSQAARDVGL
TVVLSGTGGDELFGGYPSFSRIAKFRQWFFLQRLLPKWLRKQSAYTAQFLSVPINLYKLF
AFLGTDGSIAELHPITREVFNNYQINQLLSDGLRENFYINELRNAYSQNMAQEDIFNQIS
YAELITYLRDLLLIDIDQTSMAHGLEVRVPFLDKNFVEFVLGLPGYLKAQGNSPKSLLTC
SFPHLLPSQIQKRNKQGFTLPFEIWMKGSLKHFCEERLAELNQLNFSQDKVWQFWKKFQQ
GDKSLSWSRLWLLVVLSDWCNRHKITI
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaattgctggtatatataattactcagagtctttttctctagatgagattagg
aaaaatatctgtcaaatgacagatgctttaactcatcgaggtccggatgatcatggagtt
tggtgtcaagagaacattgcattaggacataggcgattaagcatccttgacttgtctcct
ctgggaggacagcctatgttttctaatgatcgaaatatagtcacagtttttaatggagaa
atttataattttcaggagttgaaaagggaacttgagaaagattactcatttcaatctcaa
acagataccgaagtgattatagcagcctacaaaaaatggggtgaagcttgtgttgaaaag
ttttctggaatgtttgcctttgctttatgggatattagcaaaaattctcttttcctggct
cgggatcatttgggaattaaacccttatattattatcaaacgaatggtttacttctattt
gcttcggaaattagaagcttacttgctacaagcttaatcaaacgctctatagaccccatc
agtttaaagttacttctaagttatcaaaccgttcctgctccccgctccattttacaagat
gttcaaatcttactacccggaaatgcactaataatcaaaaatggtcaagttaaacaatgg
tgctattggaagcctaatcattatgttattaataagccaattatagactatgagaaatcc
attcaaattcaagttgcagaacgactacaaactgctgttaaaaatcatttagtcagtgat
gttcctttaggtgttttcttatctggtgggatagattctagtacattagttggccttgct
cgtcaagcctcattagaagatattcacacagtttcaattatttttgatgaaccagaatat
aatgaactgtcctatatttctcaagtagccgaacgctttcaaacacagcatactaatgtt
catttaagtagcacagatttattaaaacaactcccaaaattcttagaagatcttgatcga
cctaccggtgatggagtcaattcttatgttgtttctcaagcagcacgagatgtgggactg
acagttgtcttatctggaactggaggcgatgagttatttggcggttatccttcttttagt
agaattgctaaatttcgtcaatggttttttttacaaagactattgcctaaatggctacga
aaacaatctgcctatacggctcaatttttatcagttccaattaatttatataagttattt
gcctttctgggaacggatgggagtattgccgaattacatccgattacccgagaggtgttt
aataattaccaaatcaatcaactgttaagtgatgggctgagggaaaatttttatattaat
gagttacgaaatgcttattctcaaaatatggctcaggaagatatttttaatcaaatctct
tatgcagagctaataacttatttacgagatctattacttatagatattgatcaaacaagt
atggctcatggcttagaagtaagagttccttttttagacaaaaattttgttgaatttgtc
ttgggattgccaggatatcttaaagctcaaggaaattctcctaagtctcttttaacctgt
tcttttccccatttactcccttctcaaattcagaagcgaaataaacaggggtttactctt
ccttttgaaatttggatgaaaggtagtttaaagcatttttgtgaagaacgattagctgaa
cttaatcaattaaatttttctcaggataaagtttggcaattttggaaaaaatttcagcaa
ggagataaaagcttatcttggtctagattgtggttacttgttgtcttaagtgattggtgt
aatcgacataaaatcactatttaa

DBGET integrated database retrieval system