KEGG   Cyanothece sp. PCC 8802: Cyan8802_0186Help
Entry
Cyan8802_0186     CDS       T00968                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cyh  Cyanothece sp. PCC 8802
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cyh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cyan8802_0186
   01230 Biosynthesis of amino acids
    Cyan8802_0186
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cyan8802_0186
   00030 Pentose phosphate pathway
    Cyan8802_0186
   00051 Fructose and mannose metabolism
    Cyan8802_0186
   00052 Galactose metabolism
    Cyan8802_0186
  Energy metabolism
   00680 Methane metabolism
    Cyan8802_0186
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Cyan8802_0186
Enzymes [BR:cyh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Cyan8802_0186
Protein phosphatases and associated proteins [BR:cyh01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Cyan8802_0186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
184801..185973
Genome map
AA seq 390 aa AA seqDB search
MTKKIGILTSGGDCPGLNAVIRAVVKASYLKGWTVYGIPYGTDGFIDIANGKYQPDDLIL
TGHSYDLPGMLKGLDVLQFLSGSVLGSLSKGHPEEEHNRIAILQGYERLGLEALIVVGGD
GSLDIIYDLAQAGNWNIIAIPKTIDNDVPYTDYSVGFRTAVEIVTQALYDLTFTAASHER
VMLVQVMGRDAGHLALHAGIAGGADIILIPELTPYLTPETINGCCCQLANLRSSGRQFAL
VVISEGVKNQQQQKEKYIAEYLSHCISQQIQVLREAGEKAFCDPIDVDLRVTVLGHLQRS
HTPVALDRLLATVFGIKAVELIAEQRYDRIVVWREGQVHSTPLKSIINVLKQCHHEKRCA
YPVDPSGFMIQTARSLGIYLGESFDTTRKV
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaaaatcggtattctcaccagtgggggagactgtccagggttaaatgctgtc
attcgagcagtggttaaagcctcttacctcaaaggatggacagtttacggtatcccctac
ggaacagatggctttattgacatcgctaacggaaaatatcaacccgacgatttaatccta
acgggacacagttacgacttacccggaatgctaaaggggttagatgttcttcaattcctc
agtggtagcgttttgggttccctaagcaaaggacaccccgaagaagaacacaatcgcatc
gctattctccaaggctatgaacgattagggttagaagctttaattgtcgttggtggggat
ggaagtcttgatattatttacgatttagcccaagcagggaactggaatattattgccatt
ccgaaaaccattgataatgatgtcccctataccgattattctgttgggtttagaacggca
gtagaaattgttacccaagccttatacgacctaacctttacggctgccagtcatgaacgg
gtgatgttagtccaagtcatgggacgcgatgccggacatttagccctccatgcagggatt
gccgggggggcagatattattctcattcccgaactaaccccctatttaaccccagaaacc
attaatggctgttgctgtcaactagcgaacctaagatcatctggccgtcagtttgcccta
gtggttatttccgaaggggtgaaaaaccaacaacaacaaaaagaaaagtatattgcggag
tatttatcccactgtattagtcaacagattcaggtgttacgcgaagctggtgaaaaagct
ttctgtgaccccattgatgtcgatctccgtgtcaccgttctgggtcatttgcagcgcagt
catacccccgttgccttagatcgtctactagcgacggtttttggcattaaagctgtggaa
ttaatcgccgaacaacgctatgatcgtattgtcgtctggcgcgaaggacaagtccacagt
actcccctaaaatcgatcattaatgtcctcaaacaatgccatcatgaaaaacgctgtgct
tatcccgttgatccttctggatttatgattcaaacagcgcgatcgctagggatttacctc
ggagagagttttgacacgacccgaaaagtttag

DBGET integrated database retrieval system